KEGG   Cricetulus griseus (Chinese hamster): 100774478Help
Entry
100774478         CDS       T02813                                 

Gene name
Kat2a
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100774478 (Kat2a)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100774478 (Kat2a)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100774478 (Kat2a)
  Infectious diseases
   05166 HTLV-I infection
    100774478 (Kat2a)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100774478 (Kat2a)
Transcription machinery [BR:cge03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100774478 (Kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 760 aa AA seqDB search
MAEPSQAPNPAPAAQPRPLQSPAPAPTPPPAPTCKANETCKCNGWKNPKPPTAPRMDLQQ
PAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVY
FYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELS
KMFLLCLNYWKLETPAQFRQRSQSEDVAAYKVNYTRWLCYCHVPQSCDSLPRYETTHVFG
RSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESG
FTMPPSEGTQLVPRPATVSAAVVPSTPIFSPTMGGGSNSSLSLDSTGAEPMPVGEKRKLP
ENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRG
IIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDG
RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEY
AIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKK
LIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTL
KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADL
QRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttctcaggccccaaacccggccccagccgcgcaaccccggccccttcag
tccccggcccctgccccaactccgccccctgcccccacttgcaaggccaatgaaacctgc
aagtgtaatggctggaaaaaccccaaaccccccactgcacctcgcatggaccttcagcag
ccagctgccaacctgagcgagctgtgccgcagctgtgagcaccccttggccgaccatgtg
tcccacctggagaatgtgtcagaggatgagattaaccggctcttgggaatggtggtagat
gtagaaaatctgttcatgtctgttcacaaggaagaggacacagacaccaaacaggtctat
ttctaccttttcaagctcttgcggaaatgcatcctgcagatgactcgacctgtggtagag
ggatccctaggcagccccccatttgagaaacccaacattgagcagggtgtactgaacttt
gtgcagtacaaatttagccaccttgccccccgagagcggcagacaatgtttgagctctcc
aaaatgttcctgctctgccttaactactggaaactggagacacctgctcagttccggcag
cggtcccagtctgaggatgtggctgcctacaaggtcaattacaccagatggctctgttac
tgccacgtgccccagagctgcgatagcctcccccgttacgagaccacccatgtctttggc
cgaagccttctgcgatccattttcacagtcacccgccggcagctactggaaaaattccga
gtggagaaggacaagctggtgcctgagaagaggacccttatcctcactcacttccccaag
ttcctgtccatgcttgaggaggagatctacggggcaaattctcccatctgggagtctggc
ttcacgatgccaccatcagaggggacccagctggtgccccggccagcaacagtcagtgca
gcggttgttcccagcacccctatctttagtcccaccatgggtggaggcagcaacagctcc
ctgagcctggattctacaggggccgagcccatgccagtaggagagaagaggaagcttcct
gagaacctcacgctggaggatgctaagcggctccgagtgatgggtgacatccccatggag
ctggtcaacgaggtcatgttgaccatcactgaccccgctgccatgctagggcctgagacg
agcctactctcagccaacgcagcccgagacgaaacggctcgcctggaggagcggcgaggc
attatcgagttccacgtcattggtaactcgctgacacccaaggccaaccggagagtgctg
ctctggcttgtggggctgcagaacgtcttttcccaccagctgccacggatgccgaaggaa
tacattgcccgcctcgtctttgacccgaagcataagacgctggccttgatcaaggatggg
cgtgtcatcggcgggatttgcttccgcatgttccccactcagggcttcacggaaatcgtc
ttctgtgctgtcacctcaaatgagcaggtcaagggctatggcacacatctgatgaaccac
ctaaaggagtaccacatcaaacacagcatcctttactttctcacctatgctgacgaatat
gccatcggctatttcaaaaagcagggcttctccaaggacatcaaggtgcccaagagccgg
tacctgggttacatcaaggactatgaaggagcgacgctgatggagtgtgagctgaatccc
cggattccctacacagagctgtcccacatcatcaagaaacaaaaggagatcatcaagaaa
ttgattgagcgcaaacaggcacagatccgaaaggtctaccctggactcagctgcttcaag
gagggagtgagacagattcctgtggagagcgttcctggcattcgagagacaggatggaag
cccttgggaaaggagaagggcaaggagctgaaggaccctgatcagctgtacacaactctc
aaaaacctgttggctcagatcaagtcacaccccagtgcctggcccttcatggaacctgtg
aagaaatcagaggctcccgactactacgaggttatccgcttccccattgacctgaagacc
atgacagaacggttacgcagtcgctactacgtgacccggaagctctttgtagctgacctg
cagcgggtcatcgccaactgccgggagtacaatcccccagacagtgaatattgtcgctgt
gccagtgccctggagaagttcttctacttcaagctcaaggagggagggctcattgacaag
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system