KEGG   Cricetulus griseus (Chinese hamster): 100774568Help
Entry
100774568         CDS       T02813                                 

Gene name
Ncoa3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100774568 (Ncoa3)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100774568 (Ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1395 aa AA seqDB search
MSGLGESSLDPLATESRKRKLPCDAPGQGLAYSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEQDRKDFLKHLPKSTVN
GVSWTNETQRQKSHTFNCRMLMKTHDILEDMSASPETRQRYETMQCFALSQPRAMLEEGE
DLQCCMICVARRVTTGERTLPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDTIRRC
IQRFFSPNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDR
HGFISTHFLQREQNGYRPNPNSVGQGIRPPAAGCGMNMSPNQSGQTLGSRTYGVADPSNA
GQMGGARYGPSNNIASLTPGQSLQSPSSYQNSSYGLNMSSPPHGSPGLGPNQQNIMISPR
NRGSPKMASHQFSPVAGVHSPMGSAGAPGSHSFSSSSLSALQAISEGVGTSLLSTLSSPG
PKLDNSPNMSVNQPSKGGRQDSKSPLGLYCEQNPVESSVCQSNSREHPGEKESKESSGEG
SETQRGPLESKGHKKLLQLLTCSSDDRGHSSVTNSPLDSNCKDSSTSVTSPSGVSSSTSG
AVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTAPCGGEGNARQE
QLSPKKKENNALLRYLLDRDDPSDALAKELQPQADVGDSKLSQCSSSTNPSSSQDKDSKI
KTETSEEVSGDLDNLDAILGDLTSSEFYNNPVSTNGTHPGTKQQMFAGPSSLGLRSPQPV
QPVRPPYNRAVSLDSPVSVGSGPPVKNVSAFPVLQKQPTLAGNPRVMDSQENYGASMGGP
NRNVAVAVNQTSSPGEWSLANSKASRMEPMGSSPLGRTGDYSAALPRPAMGGSVPTLPLR
PNRIPGARPTLQQQQQQQQQMLQMRTGEIPMGMGVNPYGQAAAPSNQPGSWPEGMLPMEQ
GPHGTQNRPLLRNPLEDLLGPPSNAEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIP
ELVNQGQALEAKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPMQGGFNLQGQSPSFNSMM
NQISQQGSFPLQGMHPRASMVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPT
GGAAVMRPMMQPQQAFFNAQMAAQQKRELMNHHLQQQRMAMMMSQPQPQAFSPPPNVTAS
PSMDGVLAGSAMPQAPPQQFPYPTNYGMGQPPDPAFGRVSSPPNAMMSSRMGPSQNAMVQ
HPQTAPMYQSSEMKGWPSGNLARNSSFPQQQFAPQGKPAAYNMVHMNNSGGHLGQMNMTP
MSMSGMPMGPDQKYC
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atgagtggactaggtgaaagctccttggatccgctggccactgagtctcgaaaacgaaaa
ttgccttgtgatgctccaggacagggtcttgcctacagtggtgaaaagtggagacgggag
caggagagcaaatacatagaagaattggctgaactgatatctgcaaatcttagtgatatt
gacaatttcaacgtcaaaccagataaatgtgcgattttaaaggaaacagtgagacagata
cgtcaaataaaagagcaaggaaaaactatttccagtgatgatgatgttcagaaagctgat
gtatcctctacaggacagggggtcattgataaagactctttagggccacttttactacag
gcattggatggttttctgtttgtggtgaatcgagacggcaacattgtatttgtgtcagaa
aatgtcacacagtatctgcagtacaagcaggaagacctggttaacacaagtgtctacagc
atcttacatgagcaggaccggaaggacttccttaaacacttacccaaatccacagttaat
ggagtttcttggactaatgagacccagagacaaaaaagccatacctttaattgtcgtatg
ttgatgaagacacacgatattttggaagacatgagtgccagtcctgaaactcgccagaga
tatgaaacaatgcagtgcttcgccctgtctcagcctcgagccatgctggaagaaggggaa
gacttgcagtgctgtatgatctgcgtggcacgccgagtgactacaggggaaaggacactc
ccatcaagtcctgagagctttattactaggcatgacctgtcaggaaaggtcgtcaatata
gatacaaactcactgagatcttccatgaggcctggctttgaagataccatccgaaggtgt
atccagagattctttagtcctaatgatgggcagtcatggtcccagaagcgtcactatcaa
gaagcttatattcatggccatgcagagaccccagtgtaccgcttctcattggcggatgga
actattgttagtgcacagacaaaaagcaagctcttccgaaatcctgtaacgaatgatcgt
catggcttcatttcaacccactttcttcagagagaacagaatggatatagaccaaacccc
aattctgtaggacaaggcatccggcctcctgcagcagggtgcggcatgaacatgtctccc
aatcagagtggacagacactgggcagcaggacctatggtgtggcagaccccagcaatgcc
gggcagatgggtggagctaggtatgggccctccaataacatagcctcgctgacccctgga
caaagcctgcagtcaccatcttcctaccagaatagcagctatgggctcaacatgagcagc
ccccctcatggcagtcctggtcttggccccaaccagcaaaacatcatgatttctccacgt
aatcgcgggagcccaaagatggcctcacaccagttctctcctgttgcaggtgtgcactct
cccatgggatccgctggcgctccagggagtcacagcttttccagcagctccctcagtgcc
ttgcaagccattagcgagggtgtggggacttctcttttatccactctgtcttcaccaggc
cccaagttggataactctcccaatatgagtgtaaaccagccaagtaaaggaggcaggcag
gactccaagagccccctaggcttatactgtgaacagaatccagtggagagctcagtgtgt
caatcaaatagcagagagcaccctggtgagaaagaaagcaaagagagcagtggggagggc
tcggagacacagaggggtcccctggaaagcaaaggccacaagaaactgctgcagctactc
acatgctcttctgatgaccgaggccattcctctgtgaccaactcccccctggattcaaat
tgcaaagactcttccactagtgtcaccagcccctctggagtatcctcctcaacatcagga
gctgtgtcttccacctccaatgtacatgggtctctgttgcaagagaaacaccggattttg
cacaagttgctgcagaatggcaactcaccagcagaagtcgccaagatcactgcagaggcc
accgggaaagacactagcagtactgctccctgtggtggagaagggaatgccaggcaggag
cagctgagtcccaagaagaaggagaataatgccctcctcagatacctgctggacagggat
gaccccagcgatgcccttgccaaagagctgcagccccaagcggacgtaggtgacagtaaa
ctgagtcagtgcagcagctccaccaatcccagctccagccaagacaaagattccaaaatt
aagacagagaccagtgaggaggtatctggagatctggataatctagacgctattcttggt
gatttgactagttctgagttttacaacaaccctgtatctacaaatggcacccatccaggg
accaaacagcagatgtttgcaggaccaagttctctgggtttgcgaagtccacagcctgtg
cagcctgtccgtcctccgtataaccgagccgtgtctcttgatagtcctgtgtctgttggc
tcaggtcctccagtgaagaatgtcagtgctttcccggtgttacaaaaacagcctacactg
gctgggaatccaagagtgatggatagtcaggagaattacggtgccagtatgggtggacca
aacagaaatgtcgctgttgctgtgaatcagacttcttccccaggagagtggagcttggct
aactcaaaggccagcagaatggaacccatgggatcaagtcccctgggaagaacaggagac
tacagtgctgctttgccaagacctgccatggggggctcagtgcccactttgcctcttcgt
cctaatagaataccaggtgcaagaccaacgttgcagcagcagcagcagcaacagcagcag
atgcttcaaatgagaactggtgagattcccatgggaatgggggtcaatccctatggccaa
gcagcagcaccatctaatcaaccgggctcctggccagagggcatgctgcctatggaacaa
ggtcctcatgggactcaaaataggcctcttcttagaaatcctctggaggacctgcttggg
ccgccttctaacgcagaaggccagagtgatgaaagagcgctgctggaccagctgcacact
ctcctgagcaacacagatgcgacaggcctggaagaaatcgacagggccttgggcatccct
gagcttgtgaatcaggggcaagctttggaggccaaacaagatgtttttcaaggccaagaa
gcagcagtgatgatggatcagaaggctgcactctatggacagacttacccagcccagggt
cctccaatgcaaggaggctttaacctccagggacagtcgccatcttttaactctatgatg
aatcagattagccagcaaggcagctttcctctccaagggatgcatcccagagccagcatg
gtgagaccgaggacaaacaccccgaagcagctgaggatgcaacttcagcagaggctgcag
ggccaacagtttttgaatcagagccggcaggcacttgagatgaaaatggaaaaccctact
ggtggcgctgctgtgatgaggcccatgatgcagccccagcaggctttctttaatgctcaa
atggctgcccagcagaaacgagagctgatgaaccatcacctgcaacagcagagaatggca
atgatgatgtcacagccgcagcctcaggccttcagcccacctcccaatgtcactgcttcc
cctagcatggatggggttttggcaggatcagcaatgccacaagccccaccgcagcagttt
ccatatccaacgaattatggaatgggacaaccacctgatccagcttttggtcgagtatcc
agtcctcccaatgcaatgatgtcatcaagaatggggccttcccagaatgccatggtgcag
catcctcagactgcacccatgtatcagtcctcagaaatgaaggggtggccatcagggaac
ctggccagaaacagctcctttccccagcagcagtttgctccccaggggaagcctgcagca
tacaacatggtgcacatgaacaacagtggtggccacctgggacagatgaacatgaccccc
atgtccatgtctggcatgcccatgggtcccgatcagaaatactgctga

DBGET integrated database retrieval system