KEGG   Cricetulus griseus (Chinese hamster): 100774568Help
Entry
100774568         CDS       T02813                                 

Gene name
Ncoa3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100774568 (Ncoa3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100774568 (Ncoa3)
   05224 Breast cancer
    100774568 (Ncoa3)
  Drug resistance
   01522 Endocrine resistance
    100774568 (Ncoa3)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100774568 (Ncoa3)
Chromosome [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100774568 (Ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1395 aa AA seqDB search
MSGLGESSLDPLATESRKRKLPCDAPGQGLAYSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEQDRKDFLKHLPKSTVN
GVSWTNETQRQKSHTFNCRMLMKTHDILEDMSASPETRQRYETMQCFALSQPRAMLEEGE
DLQCCMICVARRVTTGERTLPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDTIRRC
IQRFFSPNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDR
HGFISTHFLQREQNGYRPNPNSVGQGIRPPAAGCGMNMSPNQSGQTLGSRTYGVADPSNA
GQMGGARYGPSNNIASLTPGQSLQSPSSYQNSSYGLNMSSPPHGSPGLGPNQQNIMISPR
NRGSPKMASHQFSPVAGVHSPMGSAGAPGSHSFSSSSLSALQAISEGVGTSLLSTLSSPG
PKLDNSPNMSVNQPSKGGRQDSKSPLGLYCEQNPVESSVCQSNSREHPGEKESKESSGEG
SETQRGPLESKGHKKLLQLLTCSSDDRGHSSVTNSPLDSNCKDSSTSVTSPSGVSSSTSG
AVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTAPCGGEGNARQE
QLSPKKKENNALLRYLLDRDDPSDALAKELQPQADVGDSKLSQCSSSTNPSSSQDKDSKI
KTETSEEVSGDLDNLDAILGDLTSSEFYNNPVSTNGTHPGTKQQMFAGPSSLGLRSPQPV
QPVRPPYNRAVSLDSPVSVGSGPPVKNVSAFPVLQKQPTLAGNPRVMDSQENYGASMGGP
NRNVAVAVNQTSSPGEWSLANSKASRMEPMGSSPLGRTGDYSAALPRPAMGGSVPTLPLR
PNRIPGARPTLQQQQQQQQQMLQMRTGEIPMGMGVNPYGQAAAPSNQPGSWPEGMLPMEQ
GPHGTQNRPLLRNPLEDLLGPPSNAEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIP
ELVNQGQALEAKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPMQGGFNLQGQSPSFNSMM
NQISQQGSFPLQGMHPRASMVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPT
GGAAVMRPMMQPQQAFFNAQMAAQQKRELMNHHLQQQRMAMMMSQPQPQAFSPPPNVTAS
PSMDGVLAGSAMPQAPPQQFPYPTNYGMGQPPDPAFGRVSSPPNAMMSSRMGPSQNAMVQ
HPQTAPMYQSSEMKGWPSGNLARNSSFPQQQFAPQGKPAAYNMVHMNNSGGHLGQMNMTP
MSMSGMPMGPDQKYC
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atgagtggactaggtgaaagctccttggatccgctggccactgagtctcgaaaacgaaaa
ttgccttgtgatgctccaggacagggtcttgcctacagtggtgaaaagtggagacgggag
caggagagcaaatacatagaagaattggctgaactgatatctgcaaatcttagtgatatt
gacaatttcaacgtcaaaccagataaatgtgcgattttaaaggaaacagtgagacagata
cgtcaaataaaagagcaaggaaaaactatttccagtgatgatgatgttcagaaagctgat
gtatcctctacaggacagggggtcattgataaagactctttagggccacttttactacag
gcattggatggttttctgtttgtggtgaatcgagacggcaacattgtatttgtgtcagaa
aatgtcacacagtatctgcagtacaagcaggaagacctggttaacacaagtgtctacagc
atcttacatgagcaggaccggaaggacttccttaaacacttacccaaatccacagttaat
ggagtttcttggactaatgagacccagagacaaaaaagccatacctttaattgtcgtatg
ttgatgaagacacacgatattttggaagacatgagtgccagtcctgaaactcgccagaga
tatgaaacaatgcagtgcttcgccctgtctcagcctcgagccatgctggaagaaggggaa
gacttgcagtgctgtatgatctgcgtggcacgccgagtgactacaggggaaaggacactc
ccatcaagtcctgagagctttattactaggcatgacctgtcaggaaaggtcgtcaatata
gatacaaactcactgagatcttccatgaggcctggctttgaagataccatccgaaggtgt
atccagagattctttagtcctaatgatgggcagtcatggtcccagaagcgtcactatcaa
gaagcttatattcatggccatgcagagaccccagtgtaccgcttctcattggcggatgga
actattgttagtgcacagacaaaaagcaagctcttccgaaatcctgtaacgaatgatcgt
catggcttcatttcaacccactttcttcagagagaacagaatggatatagaccaaacccc
aattctgtaggacaaggcatccggcctcctgcagcagggtgcggcatgaacatgtctccc
aatcagagtggacagacactgggcagcaggacctatggtgtggcagaccccagcaatgcc
gggcagatgggtggagctaggtatgggccctccaataacatagcctcgctgacccctgga
caaagcctgcagtcaccatcttcctaccagaatagcagctatgggctcaacatgagcagc
ccccctcatggcagtcctggtcttggccccaaccagcaaaacatcatgatttctccacgt
aatcgcgggagcccaaagatggcctcacaccagttctctcctgttgcaggtgtgcactct
cccatgggatccgctggcgctccagggagtcacagcttttccagcagctccctcagtgcc
ttgcaagccattagcgagggtgtggggacttctcttttatccactctgtcttcaccaggc
cccaagttggataactctcccaatatgagtgtaaaccagccaagtaaaggaggcaggcag
gactccaagagccccctaggcttatactgtgaacagaatccagtggagagctcagtgtgt
caatcaaatagcagagagcaccctggtgagaaagaaagcaaagagagcagtggggagggc
tcggagacacagaggggtcccctggaaagcaaaggccacaagaaactgctgcagctactc
acatgctcttctgatgaccgaggccattcctctgtgaccaactcccccctggattcaaat
tgcaaagactcttccactagtgtcaccagcccctctggagtatcctcctcaacatcagga
gctgtgtcttccacctccaatgtacatgggtctctgttgcaagagaaacaccggattttg
cacaagttgctgcagaatggcaactcaccagcagaagtcgccaagatcactgcagaggcc
accgggaaagacactagcagtactgctccctgtggtggagaagggaatgccaggcaggag
cagctgagtcccaagaagaaggagaataatgccctcctcagatacctgctggacagggat
gaccccagcgatgcccttgccaaagagctgcagccccaagcggacgtaggtgacagtaaa
ctgagtcagtgcagcagctccaccaatcccagctccagccaagacaaagattccaaaatt
aagacagagaccagtgaggaggtatctggagatctggataatctagacgctattcttggt
gatttgactagttctgagttttacaacaaccctgtatctacaaatggcacccatccaggg
accaaacagcagatgtttgcaggaccaagttctctgggtttgcgaagtccacagcctgtg
cagcctgtccgtcctccgtataaccgagccgtgtctcttgatagtcctgtgtctgttggc
tcaggtcctccagtgaagaatgtcagtgctttcccggtgttacaaaaacagcctacactg
gctgggaatccaagagtgatggatagtcaggagaattacggtgccagtatgggtggacca
aacagaaatgtcgctgttgctgtgaatcagacttcttccccaggagagtggagcttggct
aactcaaaggccagcagaatggaacccatgggatcaagtcccctgggaagaacaggagac
tacagtgctgctttgccaagacctgccatggggggctcagtgcccactttgcctcttcgt
cctaatagaataccaggtgcaagaccaacgttgcagcagcagcagcagcaacagcagcag
atgcttcaaatgagaactggtgagattcccatgggaatgggggtcaatccctatggccaa
gcagcagcaccatctaatcaaccgggctcctggccagagggcatgctgcctatggaacaa
ggtcctcatgggactcaaaataggcctcttcttagaaatcctctggaggacctgcttggg
ccgccttctaacgcagaaggccagagtgatgaaagagcgctgctggaccagctgcacact
ctcctgagcaacacagatgcgacaggcctggaagaaatcgacagggccttgggcatccct
gagcttgtgaatcaggggcaagctttggaggccaaacaagatgtttttcaaggccaagaa
gcagcagtgatgatggatcagaaggctgcactctatggacagacttacccagcccagggt
cctccaatgcaaggaggctttaacctccagggacagtcgccatcttttaactctatgatg
aatcagattagccagcaaggcagctttcctctccaagggatgcatcccagagccagcatg
gtgagaccgaggacaaacaccccgaagcagctgaggatgcaacttcagcagaggctgcag
ggccaacagtttttgaatcagagccggcaggcacttgagatgaaaatggaaaaccctact
ggtggcgctgctgtgatgaggcccatgatgcagccccagcaggctttctttaatgctcaa
atggctgcccagcagaaacgagagctgatgaaccatcacctgcaacagcagagaatggca
atgatgatgtcacagccgcagcctcaggccttcagcccacctcccaatgtcactgcttcc
cctagcatggatggggttttggcaggatcagcaatgccacaagccccaccgcagcagttt
ccatatccaacgaattatggaatgggacaaccacctgatccagcttttggtcgagtatcc
agtcctcccaatgcaatgatgtcatcaagaatggggccttcccagaatgccatggtgcag
catcctcagactgcacccatgtatcagtcctcagaaatgaaggggtggccatcagggaac
ctggccagaaacagctcctttccccagcagcagtttgctccccaggggaagcctgcagca
tacaacatggtgcacatgaacaacagtggtggccacctgggacagatgaacatgaccccc
atgtccatgtctggcatgcccatgggtcccgatcagaaatactgctga

DBGET integrated database retrieval system