KEGG   Cricetulus griseus (Chinese hamster): 103158988Help
Entry
103158988         CDS       T02813                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103158988
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     103158988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 127 aa AA seqDB search
WVHGTLGEAGVQQGWVGTERYLCGLQVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGP
NGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVMKDPNDHTVCY
LLFANQV
NT seq 383 nt NT seq  +upstreamnt  +downstreamnt
tttgggtgcatgggaccttaggagaggctggggtacagcaaggctgggtaggaactgaga
gatacctgtgtggcttgcaggtttacttcaaggatacccatcccaagtttcctgctggag
ggaagatgtcccagtacctggaaaacatgaatattggagacaccattgaattccggggcc
ccaatgggctgctggtctaccagggcaaagggaaattcgccatccgtgcagacaagaagt
ccaaccctgttgtcaggacagtgaagtctgtaggcatgattgcaggagggacaggtatca
ccccaatgctacaagtgatccgtgctgtcatgaaggacccaaatgaccacactgtgtgct
acctgctctttgccaaccaggtc

DBGET integrated database retrieval system