KEGG   Corynebacterium glutamicum SCgG2: C629_01620Help
Entry
C629_01620        CDS       T02691                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C629_01620
  Amino acid metabolism
   00380 Tryptophan metabolism
    C629_01620
Enzymes [BR:cgg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     C629_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357828..359378
Genome map
AA seq 516 aa AA seqDB search
MSEKSAADQIVDRGMRPKLSGNTTRHNGAPVPSENISATAGPQGPNVLNDIHLIEKLAHF
NRENVPERIPHAKGHGAFGELHITEDVSEYTKADLFQPGKVTPLAVRFSTVAGEQGSPDT
WRDVHGFALRFYTEEGNYDIVGNNTPTFFLRDGMKFPDFIHSQKRLNKNGLRDADMQWDF
WTRAPESAHQVTYLMGDRGTPKTSRHQDGFGSHTFQWINAEGKPVWVKYHFKTRQGWDCF
TDAEAAKVAGENADYQREDLYNAIENGDFPIWDVKVQIMPFEDAENYRWNPFDLTKTWSQ
KDYPLIPVGYFILNRNPRNFFAQIEQLALDPGNIVPGVGLSPDRMLQARVFAYADQQRYR
IGANYRDLPVNRPINEVNTYSREGSMQYIFDAEGEPSYSPNRYDKGAGYLDNGTDSSSNH
TSYGQADDIYVNPDPHGTDLVRAAYVKHQDDDDFIQPGILYREVLDEGEKERLADNISNA
MQGISEATEPRVYDYWNNVDENLGARVKELYLQKKA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaagtcagcagcagaccagatcgtagatcgcggaatgcgtccaaagctttct
ggaaacaccacccgccacaacggagcaccagttccatctgagaacatctccgcaaccgca
ggcccacagggcccaaacgttctcaatgacattcacctcattgaaaagctcgcacacttt
aaccgcgagaacgttccagagcgtatccctcacgcaaagggccacggcgctttcggtgag
ctgcacatcaccgaggacgtatccgaatacaccaaggcagacctgttccagcctggtaag
gtcaccccgctggctgttcgcttctccactgttgctggtgagcagggctccccagatacc
tggcgcgacgtccacggcttcgctcttcgcttctacaccgaagagggcaactacgacatc
gtgggtaacaacaccccaaccttcttccttcgtgacggcatgaagttcccggacttcatc
cactcacagaagcgtctcaacaagaacggtctgcgcgatgcagacatgcagtgggatttc
tggacccgcgcacctgaatctgcacaccaggtgacctacctgatgggtgaccgcggtacc
cctaagacctcccgccaccaggacggcttcggctcccacaccttccagtggatcaacgct
gaaggtaagccagtttgggttaagtaccacttcaagacccgccagggctgggattgcttc
accgatgcagaagcagcaaaggttgcaggcgagaacgctgactaccagcgcgaagacctc
tacaacgctattgaaaacggcgacttcccaatctgggacgtcaaggttcagatcatgcct
ttcgaggatgcagagaactaccgctggaacccattcgatctgaccaagacctggtctcag
aaggattacccactgatcccagtcggttacttcatcctgaaccgcaacccacgcaacttc
ttcgctcagatcgagcagcttgcactggatccaggcaacatcgttcctggcgtcggcctg
tccccagaccgcatgctccaggcacgtgtcttcgcatacgcggaccagcagcgttaccgc
atcggcgctaactaccgcgacctgccagtgaaccgtccaatcaacgaggtcaacacctac
agccgcgaaggttccatgcagtacatcttcgacgctgagggcgagccttcctacagccct
aaccgctacgacaagggcgcaggctacctggacaacggtacggattcctcctccaaccac
acctcctacggccaggctgatgacatctacgtcaacccagacccacacggcaccgacttg
gttcgtgctgcttacgtcaagcaccaggatgatgacgacttcatccagccaggcatccta
taccgcgaggtcctggatgagggcgagaaggagcgattggcagacaacatctccaacgca
atgcagggcatctctgaggcaaccgagccacgcgtctacgactactggaacaacgttgat
gagaacctcggcgctcgcgtcaaggagctttacctccagaagaaggcttaa

DBGET integrated database retrieval system