KEGG   Corynebacterium glutamicum SCgG2: C629_06940Help
Entry
C629_06940        CDS       T02691                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C629_06940
Enzymes [BR:cgg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     C629_06940
Exosome [BR:cgg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C629_06940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1479211..1481406)
Genome map
AA seq 731 aa AA seqDB search
MTVDPASHITIPEADLARLRHCNHHDPHGFYGWHETEAGSVIRTRQIGATQVNLLIDDTS
HVMTPIGDDIFAIDLRHRERADYRLEVTWPDQEPQVKADPYYFLPTVGEMDIYLFSEGRH
ERLWEVLGANIKTYQTALGTVRGTAFTVWAPNAIGCAVVGGFNGWNASQHPMRSMGGSGL
WELFIPGIEEGEVYKFALQTKEGHRRDKADPMARRAELAPATGSIVASSEYQWQDSEWLR
ERSQTDLPSKPMSVYEVHLGSWRWGKNYEDLATELVDYVADLGYTHVEFLPVAEHPFGGS
WGYQVTGYYAPTSRWGTPDQFRALVDAFHARGIGVIMDWVPAHFPKDDWALARFDGEALY
EHPDWRRGEQKDWGTLVFDFGRNEVRNFLVANALYWIEEFHIDGLRVDAVASMLYLDYSR
EHGEWEPNIYGGRENLEAVQFLQEMNATVLRLHPGALTIAEESTSWPGVTAPTWDGGLGF
SLKWNMGWMNDTLEYFSKNPVHRAFHHSELTFSLVYAFSERFVLPISHDEVVHGKGSLWD
RMPGDTWNKAAGLRTFLAYMWSHPGKKLLFMGQEFGQREEWAEGQGLPWDIVDGWQGEYH
EAIRTLTRSLNGVYSDSPALHTQDFTGEGFTWNKGDDATNNILAFTRFGSDGSQMLCVFN
LSGTSQPEYQLGVAAGGEWKLVLNTDDAEFLGAENDIATSVQAAATPRDNFAYSLSLHVP
AMSAQFYSLQK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgaccccgcgagccacatcaccatccctgaggcagatctggcccgcctgcgc
cactgcaaccatcacgatcctcacgggttttatggttggcatgagaccgaagctggttcg
gttatccgcacgcgccagatcggcgcaacgcaggttaatttgcttatcgacgacacctct
cacgtcatgacccctatcggcgacgacattttcgcaattgatttgaggcaccgcgagcgc
gctgactatcgcttggaagtcacctggcctgatcaagaaccgcaggtcaaggctgatcca
tactacttcctccccaccgtaggcgagatggatatttacctcttctctgagggacgccat
gagcgtttgtgggaggttctcggtgccaacatcaagacctaccaaactgcgctcggaaca
gttcgtggcaccgcattcaccgtatgggctccaaacgcaattggctgcgcagtggtcggt
ggcttcaacggttggaatgcatcccagcatccgatgcgttccatgggtggttcgggtctg
tgggagcttttcatcccaggcatagaggaaggcgaagtgtacaaattcgccctccaaacc
aaggaaggccaccgccgtgacaaggccgacccaatggctcgtcgcgcagaactggcaccg
gcgaccggatctattgtcgcttcctctgagtaccagtggcaggattccgagtggctgcgc
gagcgttcccaaactgatctcccatccaagccaatgagtgtctacgaggtccacctcggt
tcttggcgctggggtaagaactatgaggatttggctactgagctggttgattacgtcgca
gatcttggctacacccacgtggaattcctccctgtcgcagagcaccccttcggcggttcc
tggggttaccaggtcaccggctactacgcaccgacctctcgttggggtactccagatcag
ttccgtgcgctagtcgatgctttccacgcccgcggtattggcgtgatcatggactgggtc
cccgctcacttccctaaggatgattgggctcttgcccgctttgatggcgaagccctttat
gaacaccctgactggaggcgcggcgaacaaaaagattggggcaccctggtctttgacttc
ggtcgcaacgaagtccgcaacttcctcgtcgctaatgcgttgtactggattgaagaattc
cacatcgatggtctgcgcgtcgacgccgtggcctccatgctgtacctcgattactcccgt
gagcacggcgaatgggaaccaaacatctacggtggtcgcgagaacctcgaggcagtgcag
ttcctgcaggaaatgaacgccacggtgctgcgactgcaccctggtgcgctcaccatcgct
gaggaatcaacttcatggcctggcgtgaccgcaccaacgtgggacggcggcttgggattc
tccctcaagtggaacatgggctggatgaacgacaccttagagtacttctccaaaaaccct
gtgcaccgcgcattccaccacagtgagctcactttctccttggtgtacgcattctctgag
cgttttgtacttccgatctctcacgatgaagtcgtccacggcaagggttccctgtgggac
cgtatgcctggcgatacgtggaacaaggccgctggtcttcgcaccttccttgcgtacatg
tggtcacacccaggcaagaagctgcttttcatgggtcaggagtttggtcagcgtgaagag
tgggctgaaggccagggactgccatgggatattgtcgacggctggcaaggcgagtaccac
gaagccatccgcactctgacccgctccctcaacggtgtctactcagactcccctgcgctg
cacactcaggatttcaccggagaaggcttcacatggaataagggcgacgacgccaccaac
aacattttggcgttcacgcgtttcggcagcgacggctcccagatgctgtgtgtattcaac
ctgtctggaacctcccagcctgagtaccagctcggtgttgcagcgggtggcgaatggaag
ctcgttctcaacactgatgatgctgaattcctcggtgcagaaaacgatatcgctacttcc
gttcaggcagcagcgacaccacgcgataatttcgcctactcactctcactgcatgtccca
gcgatgagtgctcagttctactcactgcagaagtag

DBGET integrated database retrieval system