KEGG   Corynebacterium glutamicum SCgG2: C629_10065Help
Entry
C629_10065        CDS       T02691                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:cgg00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cgg00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cgg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2171893..2173236)
Genome map
AA seq 447 aa AA seqDB search
MTVDEQVSNYYDMLLKRNAGEPEFHQAVAEVLESLKIVLEKDPHYADYGLIQRLCEPERQ
LIFRVPWVDDQGQVHVNRGFRVQFNSALGPYKGGLRFHPSVNLGIVKFLGFEQIFKNSLT
GLPIGGGKGGSDFDPKGKSDLEIMRFCQSFMTELHRHIGEYRDVPAGDIGVGGREIGYLF
GHYRRMANQHESGVLTGKGLTWGGSLVRTEATGYGCVYFVSEMIKAKGESISGQKIIVSG
SGNVATYAIEKAQELGATVIGFSDSSGWVHTPNGVDVAKLREIKEVRRARVSVYADEVEG
ATYHTDGSIWDLKCDIALPCATQNELNGENAKTLADNGCRFVAEGANMPSTPEAVEVFRE
RDIRFGPGKAANAGGVATSALEMQQNASRDSWSFEYTDERLQVIMKNIFKTCAETAAEYG
HENDYVVGANIAGFKKVADAMLAQGVI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgatgagcaggtctctaactattacgacatgcttctgaaacgcaatgctggc
gagcctgaatttcaccaggcagtggcagaggttttggaatctttgaagatcgtcctggaa
aaggaccctcattacgctgattacggtctcatccagcgcctgtgcgagcctgagcgtcag
ctcatcttccgtgtgccttgggttgatgaccagggccaggtccacgtcaaccgtggtttc
cgcgtgcagttcaactctgcacttggaccatacaagggcggcctgcgcttccacccatct
gtaaacctgggcattgtgaagttcctgggctttgagcagatctttaaaaactccctaacc
ggcctgccaatcggtggtggcaagggtggatccgacttcgaccctaagggcaagtccgat
ctggaaatcatgcgtttctgccagtccttcatgaccgagctgcaccgccacatcggtgag
taccgcgacgttcctgcaggtgacatcggagttggtggccgcgagatcggttacctgttt
ggccactaccgtcgcatggctaaccagcacgagtccggcgttttgaccggtaagggcctg
acctggggtggatccctggtccgcaccgaggcaactggttacggctgcgtttacttcgtg
agtgaaatgattaaggctaagggcgagagcatcagcggccagaagatcatcgtttccggt
tccggcaacgtagcaacctacgcgattgaaaaggctcaggaactcggcgcaaccgttatt
ggtttctccgattccagcggttgggttcatacccctaacggcgttgacgtggctaagctc
cgcgaaatcaaggaagttcgccgcgcacgcgtatccgtgtacgccgacgaagttgaaggc
gcaacctaccacaccgacggttccatctgggatctcaagtgcgatatcgctcttccttgt
gcaactcagaacgagctcaacggcgagaacgctaagactcttgcagacaacggctgccgt
ttcgttgctgaaggcgcgaacatgccttccacccctgaggctgttgaggtcttccgtgag
cgcgacatccgcttcggaccaggcaaggcagctaacgctggtggcgttgcaacctccgct
ctggagatgcagcagaacgcttcgcgcgattcctggagcttcgagtacaccgacgagcgc
ctccaggtgatcatgaagaacatcttcaagacctgtgcagagaccgcagcagagtatgga
cacgagaacgattacgttgtcggcgctaacattgctggcttcaagaaggtagctgacgcg
atgctggcacagggcgtcatctaa

DBGET integrated database retrieval system