KEGG   Corynebacterium glutamicum SCgG2: C629_11295Help
Entry
C629_11295        CDS       T02691                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C629_11295
Enzymes [BR:cgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C629_11295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2447302..2448207
Genome map
AA seq 301 aa AA seqDB search
MNNRIVVVGSINADLNVLVDRHPAPGETLLGSGGHITAGGKGANQAVAAALQGADVAFVG
AVGKDPYAAPALEFLRSSGVDLTAVSEVDDTTGLAVITVAKDGENNIVVIPGANSLVNCD
YVSSKSALLAEAGILLLQGEIPADGFKEAIHHTMGRVVVNLAPVIEVEKSALLEADPIIA
NEHEAGLILDQFGAGIDSMDPQELAQALLDAGFASVVLTLGSAGALVADATGITDIATPT
VQAVDTTGAGDAFAGAFCARLIKGDSLIDAATHAARVGAYSVQTAGAQASYPDASVSLPS
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgaattgtcgtagtcggctccatcaacgctgatcttaatgttctcgttgac
cgccacccagcacctggcgaaacactgttgggcagtggtggacacatcactgcaggaggc
aaaggcgccaaccaggcagtagctgccgctcttcaaggtgcagacgtcgcctttgtcggc
gctgtgggcaaggatccttacgctgccccagccttagaattccttcgttcctcaggcgtc
gaccttacggcagtatccgaagtagatgacaccaccgggcttgcagttatcaccgttgcc
aaagacggcgagaacaatatcgttgtcatccccggcgcgaattccctggtcaattgtgat
tatgtaagcagcaaatccgctcttttagctgaagctggaatcctgttgctgcaaggtgag
atccctgcggatggcttcaaagaggccattcaccacaccatgggtcgcgtcgtggtgaat
ctagcgcccgtcatcgaggtggagaagtccgcgttacttgaggctgatccgatcatcgcc
aatgagcacgaggccggcctgattctggatcaattcggggcaggcatcgattccatggat
ccccaggagctcgcgcaagctctcctcgacgccggtttcgcctctgttgttttaacgctt
ggatccgcaggcgcgttggtcgccgatgccaccggtatcacggacatcgccacaccaacg
gtgcaggcagttgacaccacgggagccggtgacgcttttgccggagccttctgcgcacga
ctaattaaaggcgattcgcttatcgacgccgccacccacgcagcacgcgtcggcgcttac
tcggtgcaaaccgccggagcgcaagcgtcctatccggacgcgagcgtttcacttccctct
gtttaa

DBGET integrated database retrieval system