KEGG   Corynebacterium glutamicum SCgG2: C629_12060Help
Entry
C629_12060        CDS       T02691                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C629_12060
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C629_12060
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C629_12060
Enzymes [BR:cgg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     C629_12060
Exosome [BR:cgg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C629_12060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2611319..2612740
Genome map
AA seq 473 aa AA seqDB search
MSFKRRSLAITCAITSSIVLAGISGTAAAQSSYVSGSSGLLSSSELDPETPAPLDAPKNI
IYMIGDGMGYNHVSATNLFETGQTMYQVEGEPGSVTPVEGGTPVQAFEGTEWTQLAQSTF
QDGNSYDPERAWADHNYVNENFTDSAAAGTAMATGVKTTNGMIGVNPANEPAKNTSEYAI
EKGKAAGVVSSVPFNHATPAAWAAHNSNRNDLHAMAEEMINSDLNVIMGAGHPFFDNNGN
PITEADEDYMQASQYERLASGETDFTFVEEDADFEALANGQVESDKYFGLAQVEDTLQHN
RDGDSVTPYDVPLNDVVDLSTMSKAALNVLNQDEDGFHIMIEGGAIDWAGHANDMARDIE
EVQEFNKAVETVIEWVETNSSWDETLVIVTADHETGYMTGPNDDPNWSAMTGAAGIVPNH
GWHSGNHTNQLVPVFVRGAGVSDIVAAADQVDPIRGNYIDNIEIANLTFNKWW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaagcgtcgttcgcttgcaatcacttgcgccatcacctccagcattgttctc
gctggaatctccggcaccgctgccgcccagtcctcctacgtttctggatcttcaggacta
ctgtcctccagcgagctcgatcctgaaactccagcacctctggatgctccaaagaacatc
atctacatgatcggtgacggcatgggttacaaccatgtttccgcaaccaacctgtttgaa
accggccagaccatgtaccaggtcgaaggcgagccaggttccgtcaccccagttgagggt
ggcactccagttcaggcatttgaaggcactgagtggacccagcttgcacagtccaccttc
caggacggaaactcctacgaccctgagcgcgcgtgggctgatcacaactatgtcaatgag
aacttcaccgactccgctgctgcaggaaccgcaatggcaactggtgtgaagaccaccaac
ggcatgattggcgttaacccagctaacgagcctgcgaagaacacctctgagtacgcaatt
gaaaagggcaaggcagctggcgttgtttcctctgttcctttcaaccacgcaactcctgcg
gcttgggcagctcacaactccaaccgcaatgatctgcacgcgatggccgaagagatgatc
aacagtgatctcaacgtcatcatgggtgctggccacccgttcttcgacaacaacggcaac
ccaatcacagaagccgacgaagactacatgcaggcttcccagtacgagcgcctcgcaagt
ggcgaaaccgacttcaccttcgtcgaagaggacgcagacttcgaggctctcgcaaacggc
caagttgaaagtgacaagtacttcggtctcgcgcaggtcgaagacaccctccagcacaac
cgcgacggcgactccgtcactccttacgacgttccgctcaacgacgtcgtcgacctttcc
accatgtccaaggcagccctcaacgttcttaaccaggacgaagacggcttccacatcatg
atcgaaggtggcgcaatcgactgggcaggccacgcaaacgacatggctcgcgacatcgaa
gaagtccaagagttcaacaaggccgttgaaactgtcatcgagtgggttgagaccaactcc
tcttgggatgaaaccctcgtgatcgtcaccgccgaccacgaaaccggctacatgaccggt
cctaacgatgatccaaactggtccgcaatgaccggcgctgcaggcatcgttccaaaccac
ggctggcactccggcaaccacaccaaccagctcgtcccagtgttcgttcgtggcgcaggt
gtctccgatatcgttgctgctgccgatcaagttgacccaattcgcggcaactacatcgac
aacattgagatcgcgaacctgactttcaacaagtggtggtaa

DBGET integrated database retrieval system