KEGG   Corynebacterium glutamicum SCgG2: C629_13950Help
Entry
C629_13950        CDS       T02691                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    C629_13950
   01230 Biosynthesis of amino acids
    C629_13950
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C629_13950
   00290 Valine, leucine and isoleucine biosynthesis
    C629_13950
Enzymes [BR:cgg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     C629_13950
    2.6.1.66  valine---pyruvate transaminase
     C629_13950
Amino acid related enzymes [BR:cgg01007]
 Aminotransferase (transaminase)
  Class I
   C629_13950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3052328..3053641
Genome map
AA seq 437 aa AA seqDB search
MTTDKRKTSKTTDTANKAVGADQAARPTRRTTRRIFDQSEKMKDVLYEIRGPVAAEAERM
ELDGHNILKLNTGNPAVFGFDAPDVIMRDMIANLPTSQGYSTSKGIIPARRAVVTRYEVV
PGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHYL
CDEEDDWNPSIEDIKSKISEKTKAIVVINPNNPTGAVYPRRVLEQIVEIAREHDLLILAD
EIYDRILYDDAEHISLATLAPDLLCITYNGLSKAYRVAGYRAGWMVLTGPKQYARGFIEG
LELLAGTRLCPNVPAQHAIQVALGGRQSIYDLTSEHGRLLEQRNMAWTKLNEIPGVSCVK
PMGALYAFPKLDPNVYEIHDDTQLMLDLLRAEKILMVQGTGFNWPHHDHFRVVTLPWASQ
LENAIERLGNFLSTYKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagacaagcgcaaaacctctaagaccaccgacaccgccaacaaggctgtgggc
gcggatcaggcggcgcgtcccactcggcgaacaactcgccgcatcttcgatcagtcggag
aagatgaaggacgtgctgtacgagatccgtggcccggtggccgcggaggcggaacgcatg
gagctcgacggacacaacatcctgaagctcaacactggaaacccagctgtattcggattc
gatgcacctgacgtgatcatgcgagacatgatcgcaaacctcccaacttcccaaggttat
tccacctcaaagggcatcattccagcccgccgagcagtggtaacccgctacgaagttgtg
cccggattcccccacttcgatgttgatgatgtgttcttaggcaacggtgtctcagaacta
atcaccatgaccacccaagcactcctcaacgacggcgatgaagttcttatcccagcaccg
gactacccactgtggactgccgcaacctccctggctggtggtaagcctgtgcactacctc
tgtgatgaggaagatgactggaacccatccatcgaagacatcaagtccaaaatctcagag
aaaaccaaagctattgtggtgatcaaccccaacaaccccacgggagctgtctacccgcgc
cgggtgttggaacaaatcgtcgagattgcacgcgagcatgacctgctgattttggccgat
gaaatctacgaccgcatcctctacgatgatgccgagcacatcagcctggcaacccttgca
ccagatctcctttgcatcacatacaacggtctatccaaggcataccgcgtcgcaggatac
cgagctggctggatggtattgactggaccaaagcaatacgcacgtggatttattgagggc
ctcgaactcctcgcaggcactcgactctgcccgaatgtcccagctcagcacgctattcag
gtggctctcggtggacgccagtccatttacgacctcactagtgaacacggccgactcctg
gaacagcgcaacatggcatggacgaaactcaacgaaatcccaggtgtcagctgtgtgaaa
ccaatgggtgctttgtacgcgttccccaagcttgacccgaacgtgtacgaaatccacgac
gacacccaactcatgctggatcttctccgtgccgagaaaatcctcatggttcagggcact
ggcttcaactggccacatcacgatcacttccgagtggtcaccctgccatgggcatcgcaa
ttagaaaacgcaattgagcgcctaggaaacttcctgtccacctacaagcagtag

DBGET integrated database retrieval system