KEGG   Corynebacterium glutamicum SCgG2: C629_13950Help
Entry
C629_13950        CDS       T02691                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00220  Arginine biosynthesis
cgg00250  Alanine, aspartate and glutamate metabolism
cgg00290  Valine, leucine and isoleucine biosynthesis
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
cgg01130  Biosynthesis of antibiotics
cgg01210  2-Oxocarboxylic acid metabolism
cgg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C629_13950
   00290 Valine, leucine and isoleucine biosynthesis
    C629_13950
   00220 Arginine biosynthesis
    C629_13950
Enzymes [BR:cgg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     C629_13950
    2.6.1.66  valine---pyruvate transaminase
     C629_13950
Amino acid related enzymes [BR:cgg01007]
 Aminotransferase (transaminase)
  Class I
   C629_13950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Strep_his_triad Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGN23380
Position
3052328..3053641
Genome map
AA seq 437 aa AA seqDB search
MTTDKRKTSKTTDTANKAVGADQAARPTRRTTRRIFDQSEKMKDVLYEIRGPVAAEAERM
ELDGHNILKLNTGNPAVFGFDAPDVIMRDMIANLPTSQGYSTSKGIIPARRAVVTRYEVV
PGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHYL
CDEEDDWNPSIEDIKSKISEKTKAIVVINPNNPTGAVYPRRVLEQIVEIAREHDLLILAD
EIYDRILYDDAEHISLATLAPDLLCITYNGLSKAYRVAGYRAGWMVLTGPKQYARGFIEG
LELLAGTRLCPNVPAQHAIQVALGGRQSIYDLTSEHGRLLEQRNMAWTKLNEIPGVSCVK
PMGALYAFPKLDPNVYEIHDDTQLMLDLLRAEKILMVQGTGFNWPHHDHFRVVTLPWASQ
LENAIERLGNFLSTYKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagacaagcgcaaaacctctaagaccaccgacaccgccaacaaggctgtgggc
gcggatcaggcggcgcgtcccactcggcgaacaactcgccgcatcttcgatcagtcggag
aagatgaaggacgtgctgtacgagatccgtggcccggtggccgcggaggcggaacgcatg
gagctcgacggacacaacatcctgaagctcaacactggaaacccagctgtattcggattc
gatgcacctgacgtgatcatgcgagacatgatcgcaaacctcccaacttcccaaggttat
tccacctcaaagggcatcattccagcccgccgagcagtggtaacccgctacgaagttgtg
cccggattcccccacttcgatgttgatgatgtgttcttaggcaacggtgtctcagaacta
atcaccatgaccacccaagcactcctcaacgacggcgatgaagttcttatcccagcaccg
gactacccactgtggactgccgcaacctccctggctggtggtaagcctgtgcactacctc
tgtgatgaggaagatgactggaacccatccatcgaagacatcaagtccaaaatctcagag
aaaaccaaagctattgtggtgatcaaccccaacaaccccacgggagctgtctacccgcgc
cgggtgttggaacaaatcgtcgagattgcacgcgagcatgacctgctgattttggccgat
gaaatctacgaccgcatcctctacgatgatgccgagcacatcagcctggcaacccttgca
ccagatctcctttgcatcacatacaacggtctatccaaggcataccgcgtcgcaggatac
cgagctggctggatggtattgactggaccaaagcaatacgcacgtggatttattgagggc
ctcgaactcctcgcaggcactcgactctgcccgaatgtcccagctcagcacgctattcag
gtggctctcggtggacgccagtccatttacgacctcactagtgaacacggccgactcctg
gaacagcgcaacatggcatggacgaaactcaacgaaatcccaggtgtcagctgtgtgaaa
ccaatgggtgctttgtacgcgttccccaagcttgacccgaacgtgtacgaaatccacgac
gacacccaactcatgctggatcttctccgtgccgagaaaatcctcatggttcagggcact
ggcttcaactggccacatcacgatcacttccgagtggtcaccctgccatgggcatcgcaa
ttagaaaacgcaattgagcgcctaggaaacttcctgtccacctacaagcagtag

DBGET integrated database retrieval system