KEGG   Cryptococcus gattii: CGB_A1040WHelp
Entry
CGB_A1040W        CDS       T02232                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cgi  Cryptococcus gattii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGB_A1040W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CGB_A1040W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:join(209637..210324,210385..210689,210743..210915,210972..211074,211129..211170)
Genome map
AA seq 436 aa AA seqDB search
MPSTTDPLADSHASPQSPRSIPTASLNNLSLLSESSTGSWERGRMTGNARSPPSSSFLSD
SLAAGVSPVVAAGVNVVEGGNGTSASSGAKGLRASGAYPQPQRPWPADKGLSRPNPTTGR
VSFPSAPQYARQAREGYGFRPKSGQTTPSTSAEAGLTYPFPSNSSSRVPRPREDDDDLDH
RPDGKSMEELRGEVREELDKQGLVQAAKGVVEPHQGIAGIADEEGLGWPAKSTHLRLHST
PEEKSANMELLTSALRTVLECIGEDPDREGLQRTPERYAKALLWMTKGYEERLVDVINDA
VFAEDHDEMVIVRDIEVFSLCEHHLVPFTGKISIGYIPSKLVLGLSKLARIAETFSRRLQ
VQERLTKQVALAVEEAIRPRGVAVVMEASHMCMSMRGVQKPGATTVTSTMLGCFRQQQKT
REEFLTLIRTPSAARH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaacaactgaccctctcgccgactcccacgcatcccctcagtctccccgttct
atccccaccgccagcctcaacaacctctctctcctctccgaatcctccactggttcttgg
gaacgcggcaggatgacaggcaatgctcgttcaccgccttctagttctttcctttccgac
tcacttgccgcaggtgtctctcctgtggttgcggcgggcgtaaacgtcgtcgaaggcggc
aacggcacatctgcgtctagtggagccaaaggtctgagggctagcggagcttaccctcaa
ccccaacgtccttggcccgctgacaagggcctctctcgacctaaccctactactggtagg
gtttccttcccttctgctccccagtatgctcgtcaggcgcgtgaaggctacggtttccgc
cccaagtccggtcagactacgcctagcaccagtgcggaagctggcttgacttatcctttc
cctagtaacagctcttctagggtgccaaggcccagagaggatgatgatgatcttgatcac
agaccggatgggaagtcgatggaggagttgaggggcgaggttagggaagaattggataaa
cagggtttggtgcaggctgccaagggagttgttgaacctcaccaggggatcgctggaatt
gccgatgaagagggtctcggctggcctgccaagtctacacatctccgcttgcactccact
cccgaagagaagtccgccaacatggagctcctcacttctgctctccgaaccgtgcttgaa
tgcattggcgaggaccctgacagggaaggattgcaacgcaccccagagagatatgccaag
gccttgttgtggatgaccaagggttacgaggagaggcttgtagatgtgatcaacgatgcg
gtctttgccgaggaccacgatgagatggttatcgtgagggatatcgaggtgtttagtctt
tgcgagcaccacttggttcctttcactggaaagatttccattggctatatccccagcaag
cttgttctgggtctttccaagctcgctcgtatcgccgaaactttctctcgtcgtcttcaa
gttcaagaacgtcttacaaagcaggtcgcccttgctgttgaagaggctattcgcccccga
ggtgtcgctgttgtgatggaggcttcgcacatgtgcatgtctatgagaggtgtccagaag
ccgggcgcgactactgtgaccagcaccatgttgggatgcttcaggcaacaacagaagacg
cgagaagagttcttgactcttatccgtacacccagtgctgccaggcactag

DBGET integrated database retrieval system