KEGG   Cryptococcus gattii: CGB_A3090WHelp
Entry
CGB_A3090W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CGB_A3090W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:join(624271..624306,624388..624441,624512..624579,624631..624773,624833..625086,625147..625195,625248..625327)
Genome map
AA seq 227 aa AA seqDB search
MAWLSSGRTNVELIENMKSSGLIHSPRVAAAMLKVDRKHYVPQRAFAYEDSPQRIGFGAT
ISAPHMHAHACENLIELLPETQNAGEEPPRILDVGSGSGYLTAVFHYLSPKSLVVGIDHI
QGLVSQSIRNLANDGVKVLDKHKIEGGGVLMLCGDGRKGSKEYAPFTVIHVGAAAPEYPE
ELVDQLAKPGRMFIPVGRGSQDVWQIDKSVNGDVTKKKLFGVMASVV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcatggctatcaagtggacgcacaaatgtagagcttattgagaacatgaaaagctct
ggcctgattcactctcctcgagtggcagcggctatgttgaaggtggatagaaaacactac
gtaccccaacgtgcatttgcctatgaggattcgcctcagcgaattggatttggagcaact
atatctgctccgcacatgcatgcccatgcatgtgaaaacctaattgaactcctgcctgag
acccagaatgctggggaagagcctcctcgaatcttggacgtgggaagcggatctggttat
ttaactgccgtcttccactatctatcacccaaatctctagttgtcggcattgatcatatt
caaggtctggtatcacagtcgatacgcaaccttgccaatgatggagtcaaagtcctcgac
aagcataagatcgaaggtggaggggttctgatgctttgcggtgatgggcgaaaaggatct
aaagaatatgcccctttcacagtcatccatgttggagcagctgctccagaataccctgaa
gaattggtagaccaactagccaagccgggaaggatgtttattcctgttggaagaggatca
caagatgtgtggcaaatcgataagtcagttaacggtgatgtgaccaagaagaagctattt
ggagtcatggcaagtgtagtctga

DBGET integrated database retrieval system