KEGG   Cryptococcus gattii: CGB_A3190WHelp
Entry
CGB_A3190W        CDS       T02232                                 

Definition
histone acetyltransferase (HAT) catalytic subunit of the SAS complex; Sas2p
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CGB_A3190W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:join(650111..650212,650271..651688,651744..651921)
Genome map
AA seq 565 aa AA seqDB search
MSPSTPSTPHGRGSGSEPGTPAPSVAVGGSYTIDDVVPGVKIYVIKPLSNGQAEQRRAEI
LSTRPKPKPSAFAPPPHPDAPPPDPRDDTEYYVHYVEFNKRLDEWVGGSRLVLSKEMEWP
KAKDDPKKKDRPGKAQPSKATPSRATGSPIPSDSLLKKAANKAAMAAGKAAPGKAIPSSK
LGKASKIGKAGKIPQKRKAKTETEPEADEESNEDNDALGEEEDLDEDGDVTLVASDGAID
PSREVVAAPSNPRAAPQVFSKKQEIEKLRTSGSMTQSHSEISRVKNLNKLQIGKHEVETW
YFSPYPIEYAHLPVLYICEFCLLYYPSATQLRRHRSKCTLLHPPGNEIYRHEGISFFEID
GRKQRTWCRNLCLISKCFLDHKTLYYDVDPFLYYCMTIKDDYGCHLIGYFSKEKESAEGY
NVACILTLPQHQRKGYGRLLIEFSYELSKVEGKLGSPEKPLSDLGLLGYRAYWQEKIVEL
LLDSDYEISLDEIAQKTSITHGDIMHTCQALQMIKYYKNSHIIHLTDAVIEQHKKTKAKP
RRAINPAYLKWKPPVFSRAQLAFGF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcaacaccatcaactcctcatggtcgagggagtggtagcgaaccgggtact
cctgcgccatccgtggctgttggaggatcatatacaattgatgatgtcgttcctggagtg
aagatctatgtcattaaacccctttcgaacggccaggccgagcaacgcagagcggaaatc
ctttccacccgtcctaaacccaaaccttcagcctttgcacctccaccgcatcctgatgca
cctcctcccgacccaagagacgatacagagtactacgttcattatgtcgagtttaataaa
cgtctagatgaatgggtcggcggaagtagactggtgttaagtaaagaaatggaatggccg
aaagcaaaggatgatccaaagaaaaaggacaggcccgggaaagctcagccttctaaggct
accccgtctagggccactggttcacctatcccttccgatagtcttctgaagaaggcggcg
aataaggctgccatggctgcaggtaaagctgctccagggaaagctataccatcttcaaaa
cttggaaaggctagcaaaattgggaaagctggcaaaattcctcaaaagcggaaggctaag
acagagacggaaccagaagcagacgaggagagtaatgaggataatgatgcattaggcgag
gaagaagatctggacgaagacggtgatgtgaccttagtcgcatcggatggcgccatcgac
cccagtcgtgaagttgttgccgccccttcaaatccccgggcggcgccccaagtgttctcc
aaaaaacaagaaatcgaaaaactcaggacgtctggctccatgacgcagtctcattcagag
atcagcagggtcaaaaatcttaacaagcttcaaatcgggaagcatgaagttgagacatgg
tatttctctccttatccgatcgaatacgcacatcttccagttctttacatttgcgaattc
tgccttctttactatccttctgccacacaactgaggcgacatagatcgaaatgtactctt
ctgcatcctccaggcaacgaaatttaccgccacgaaggtatttcgtttttcgaaatcgat
ggccgaaagcaacgcacttggtgtaggaatctatgtctcatctccaaatgcttccttgac
cataaaaccttgtactacgatgtcgaccctttcctttactactgcatgacgatcaaagat
gactacggctgtcatcttattggttacttttcgaaggaaaaggagtcagccgagggttat
aatgttgcctgtattctgactctacctcaacaccagagaaagggttatggtcgactcctg
atcgagttttcgtacgagctgtcaaaagtggaaggaaagctgggaagtcctgagaagccg
ttatcggatctgggtttgttgggttatcgggcatattggcaggagaagattgtcgagttg
ctactggacagtgattatgagatcagcctggacgagatcgcccaaaaaacgtcaatcact
catggcgatatcatgcacacttgccaggccctacaaatgatcaaatattacaagaacagc
catattatccatctgacggatgctgttattgaacaacacaagaagacaaaagctaaacct
cggcgcgccatcaacccagcgtatttgaagtggaagccgccagtctttagtagagcccaa
ttggcatttggtttctaa

DBGET integrated database retrieval system