KEGG   Cryptococcus gattii: CGB_A3550CHelp
Entry
CGB_A3550C        CDS       T02232                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cgi  Cryptococcus gattii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_A3550C
Enzymes [BR:cgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CGB_A3550C
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGB_A3550C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(762943..763157,763208..763283,763348..763510,763565..763633,763690..763762,763824..764136,764191..764252,764310..764536,764590..764695,764754..764801,764858..764889,764943..765042,765093..765401,765477..765679,765739..765766,765831..765855))
Genome map
AA seq 682 aa AA seqDB search
MAATSVSDGTGVLKIDPWLEPFSGALRERYAAYQKHRAIIEEHEGGLAEFSMGYKSMGFQ
VDKNGGVRYREWAPNATEARLIGEFNNWSHTANPMTKSPFGVWECYVPPVTPGVCPIPHD
SMVKISMTIPGGQSIDRIPTWITRVTQDLNISPIYDGRFWNPPKNQQYQFKHGHSTRPVE
GLKIYEAHVGISSPNMRVTTYKEFEVDVLPKIKELGYNCIQMMAIMEHAYYASFGYQVTN
FFAASSRYGTPEELKSLVDKAHEMGLTVLLDVVHSHASKNILDGINMYDGSDHLYFHEGG
RGRHDQWDSRLFNYGHHEVLRFLLSNLRFWMDVYMFDGFRFDGVTSMMYKHHGIGTGFSG
GYHEYFGDSVDLEAMVYLMLANAMLHENYPRVVTIAEDVSGMPTLCRPVSEGGVGFDYRL
SMAIPDMWIKLLKESTDDQWEMGHIVHNLTNRRHLEKSVAYAESHDQALVGDKTLAFWLM
DKEMYDFMSDLTPLTPIIDRGLALHKMIRFIVHTLGGEAYLNFEGNEFGHPEWMDFPREG
NGNSFAHARRQFNLVDDKLLRYKYLYEFDVAMNWLEDKYKWLNAPQAYVSLKHEGDKVIV
FERAGLLFIFNFHPTQSFTDYRVGVDTAGEYKVILTSDETRFGGHNRIDMGGRYFTTPME
WHGRNNWLQVYTPSRTVLVLGL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcagctacttcagtatcagacggcactggcgtgctgaagatcgatccttggttggaa
ccgttttctggcgccctccgtgaacgatatgccgcttatcaaaagcatcgtgccattatt
gaagagcacgaaggcggtctcgccgaattctcaatgggttataagtctatgggttttcaa
gtcgataagaatggaggtgtaaggtatcgagaatgggcccctaacgcgacagaagcgaga
ctcattggcgaattcaacaattggtcccatacggctaatcctatgacaaagtctcctttc
ggcgtatgggaatgttatgtgcctcctgttacacccggtgtttgcccgattccccatgat
tccatggtcaaaatatcaatgaccatcccaggaggtcaatctattgacagaattcctacc
tggattactcgggtcactcaagatcttaacatatctcctatatatgacggtcgcttctgg
aacccaccaaagaatcagcaatatcaattcaaacacggccattctacccggccggtagag
ggattgaaaatctacgaggcccatgtggggatttctagccccaatatgagagttaccaca
tacaaggagttcgaggtggatgtcctgccgaagataaaagagcttggctataattgtatt
cagatgatggccattatggagcacgcatactacgcctcattcggctatcaggtcaccaat
ttcttcgctgcttcgtctcgttatggtacaccggaagaactgaaatcccttgtcgataag
gcgcacgaaatgggtctaactgtacttcttgatgtggtccattcccatgctagtaaaaac
atacttgatggtatcaatatgtatgatggctctgaccacctttacttccatgaaggtggc
agaggcagacacgatcaatgggattctcgccttttcaattatggccaccatgaagtgctc
cgctttttgctttctaacctccgattctggatggacgtatacatgtttgatggcttcagg
ttcgatggtgtcaccagcatgatgtataagcatcatggtattggtacaggtttctcagga
ggatatcatgaatacttcggcgattctgtggatcttgaagccatggtatatctcatgctg
gcaaatgctatgctgcacgagaattatcctcgtgttgtcactatagcagaggatgtctct
gggatgcccacgctttgccgtccagtttcagagggtggtgttggatttgattatcgactt
tccatggccatccctgacatgtggatcaagcttctcaaagaatccacggatgatcagtgg
gagatgggccacattgtccacaaccttactaatcgaagacacttggagaagagtgttgca
tacgctgaaagtcatgatcaagctttggttggggacaagactttagccttctggttgatg
gataaggagatgtatgactttatgtctgatcttacccctttgactcctattatcgacagg
ggtttagctcttcataaaatgataagattcattgtccacacacttggaggagaggcgtat
ctcaattttgaagggaatgagttcggacatcctgaatggatggatttcccacgagagggt
aacggcaactcttttgcccatgctcgtcgtcagttcaaccttgtggatgacaagttgttg
cgttacaaatatctctatgagtttgacgtggctatgaactggctggaagacaagtacaag
tggctcaacgcccctcaagcttatgtttcccttaaacatgaaggagacaaggtgattgtg
tttgaaagagccggtctgctgttcattttcaacttccatccgacacaatcattcaccgac
taccgagttggcgtagatactgcaggagaatacaaggtcatcttgacaagtgacgaaacc
agatttggcggacacaatcgcattgatatgggtgggaggtatttcacaacacccatggaa
tggcatgggcgaaacaactggcttcaagtctacacgccttcgaggactgtcctagtcctc
gggctttag

DBGET integrated database retrieval system