KEGG   Cryptococcus gattii: CGB_A3580CHelp
Entry
CGB_A3580C        CDS       T02232                                 

Definition
protein serine/threonine kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cgi  Cryptococcus gattii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CGB_A3580C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CGB_A3580C
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CGB_A3580C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(769269..769353,769408..769637,769688..769744,769800..769882,769934..770138,770187..770451,770498..770709,770752..770992,771044..771060))
Genome map
AA seq 464 aa AA seqDB search
MEDIQGDSSLVQQPVATGKAPVVEPSASTSSSTVTGQGGTVSSALGAQGMLAATTEGPRQ
LQSPVSRTSSADEDRMREKARGAQEQAAQAQANLHNATQQARVAAINAAATQAALETATQ
QPATARVPTSGVGAEPGQARRKTAGRYALSDFLIERTLGTGSFGRVHLVRSRHNSRFYAV
KVLNKEKVIKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNNLYMVMDFVAGGELFSL
LRKSQRFPNSVAKFYAAEVALALDYLHSLDIIYRDLKPENLLLGADGHVKVTDFGFAKYV
PDITWTLCGTPDYLAPEVVQSKGYNKSVDWYALGVLIFEMLAGYPPFFTEDGNPMKLYEK
IIAGKVRYPTYFDVLAKELLKNLLVGDLTKRYGNLRAGSSDIFAHGWFAEVDWDKLYRRE
IPAPYVPKIDGEGDASQFDRYQEADVSAYGKVGNGPYDHFFLEF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaagatatacagggtgattcctcgcttgtccaacagcccgtggctactggaaaggca
cccgtagttgagccttctgcatcgacatcttcatctaccgtaactgggcaaggtggcacc
gtttcatctgctttaggcgctcaaggaatgctggcagccacaaccgaggggcctcggcaa
cttcagagtcctgtgtctcgtaccagtagtgcagatgaggataggatgagagaaaaggcg
aggggtgcccaggagcaggcagcgcaagctcaggccaaccttcataatgcaacgcaacaa
gctcgcgttgccgccatcaatgccgctgctactcaagctgcccttgaaacagccacccag
cagcctgcaacggccagggtcccaacttctggtgtgggagctgagccgggtcaagcaagg
cgcaaaacagctggccgatatgctctatctgatttccttattgaaagaactttgggcact
gggtccttcggccgtgtgcatttagtgcggtcgcgccacaacagccgtttctatgccgtt
aaagttttgaataaggagaaggtcatcaagatgaagcaagttgaacacaccaattctgaa
cgagagatgttggtacgagttcgacacccatttcttgttaatctctggggtaccttccag
gatgtaaataacctatatatggttatggattttgtggcaggaggtgaactctttagcctt
cttcgtaaaagtcagcgattcccgaattctgtcgcgaaattctacgcagccgaagttgct
ttagctctcgattatcttcattcactcgacatcatctaccgagatctcaagccagagaat
ctacttctgggcgcagacggtcatgtcaaggtcaccgactttggttttgccaagtatgtg
cccgatattacctggactctctgcgggacaccggattacctggctccggaggttgttcag
tccaagggctacaacaaaagtgtcgactggtacgctttaggggtattaatattcgaaatg
ctggcgggttatcctcccttcttcaccgaagacggcaatccaatgaaactgtatgagaag
atcattgctggcaaagtccgctatccgacatactttgacgtacttgcgaaagaactccta
aaaaatctactggttggagacctcactaagcgatacggtaatttaagagcgggctcttct
gatatatttgcccatggatggttcgccgaagtcgattgggacaagttgtacaggcgagaa
attccggctccatatgtgcccaagattgacggcgaaggagacgctagccagttcgatcgt
tatcaagaggcagatgttagtgcctacgggaaggttggcaacggtccatatgaccatttc
ttcttggagttctag

DBGET integrated database retrieval system