KEGG   Cryptococcus gattii: CGB_A5730CHelp
Entry
CGB_A5730C        CDS       T02232                                 

Definition
actin monomer binding protein
Orthology
K05759  
profilin
Organism
cgi  Cryptococcus gattii
Brite
Exosome [BR:cgi04147]
 Exosomal proteins
  Proteins found in most exosomes
   CGB_A5730C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1172142..1172222,1172442..1172492,1172583..1172659,1172721..1172784,1172881..1172978,1173175..1173187))
Genome map
AA seq 127 aa AA seqDB search
MSWQAYVDDHLVATGKVKKAAILGKQGGVWAASSGYNLSQQEQNAVTQTFFQQPDSVRAN
GITLNGFKFMCIQATPEEVIGRKGERGVFVIPTNQAILVAEYDAPTSAGEANVVVAKLAD
WLKSASY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacgttgacgaccatctcgtggccaccggaaaggtcaagaaagcc
gccatcctcggcaaacagggcggtgtttgggccgctagctctggctataacctctcccag
caagaacagaacgccgttactcagacattttttcagcaacccgacagtgtccgagcgaac
ggcatcacccttaacggtttcaagtttatgtgcatccaggcgactcctgaggaagttatc
ggtcgtaagggtgaacgaggcgttttcgtgatccctaccaatcaggctattcttgtcgct
gagtacgacgccccaacctctgccggcgaggccaatgtcgtggttgccaaacttgccgac
tggctcaagagcgcgagctactaa

DBGET integrated database retrieval system