KEGG   Cryptococcus gattii: CGB_A6170CHelp
Entry
CGB_A6170C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CGB_A6170C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1233337..1233444,1233491..1233843,1233886..1234072,1234128..1234217,1234270..1234587,1234635..1234768,1234841..1234901))
Genome map
AA seq 416 aa AA seqDB search
MAETLEEWISDSNVALNLQMVRTPEDTSLLQYEEQRNADVFSPAFTYPIFGDNEKIFGYK
GLNIKFHFASGSLRQYLDISYDTKLASSTTPPDEIEGALYKFIPPDYTKSEVEFQKRVSD
DAEAFKPLGEKIGSYVCPSAGRKGKGQGDTGTAAGKSLEDNEDVVVYEMYKATWSTPGFR
EYHRRMQIFVLLFIEGGSYVHEDEDAWEFIVLYERRKRPDSGIFTYHLVGYVSVYPFWCY
PDRVRLRLSQFVILPPYQHQGHGSKLYTTLFQHMLDRTEVAELTVEDPAEAFEDLRDRND
LRFLVKEGIEKDPMLYVDIGKGKRGSRIEWEQAIRRKYKIAQRQFDRLLEMLLFRQLDKR
NPDSVKAYRLHVKARLYRFNYEMLSQMTVDERKDALAKTYESVVEDYERILRMTFG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaacactcgaggaatggattagcgactctaatgtggctttgaacttgcagatg
gttcgcacccctgaggataccagtctccttcagtacgaggaacagcggaacgctgatgta
ttcagccctgcattcacatacccaatttttggcgataatgagaagatattcggctacaag
ggattaaatatcaaatttcactttgcctcaggaagccttcgacagtaccttgatataagc
tatgatactaaactagcatcaagcacaacgccccccgatgagattgaaggggctctttat
aaattcatcccgccagactataccaaatcagaggttgaattccaaaagagagtttctgat
gacgcggaggcattcaagcctctaggcgagaaaatcggatcgtatgtttgtccctcagcc
ggaagaaagggcaaaggccaaggagacacgggaacggcggccgggaaaagtctcgaggat
aatgaagatgtagtggtgtacgaaatgtacaaggcgacatggagtacccctggattccga
gaatatcaccgcagaatgcagatcttcgtccttcttttcattgaaggcggaagctacgta
catgaagacgaggacgcctgggaattcattgtcctttacgaacgccgcaaaagaccggat
tctggcatcttcacctatcatctcgttggctacgtttctgtctacccattttggtgttat
ccggaccgcgtaaggttacgtctgagccagtttgtcattttgcccccttatcaacatcag
ggtcacggctccaagttgtacaccacactctttcaacatatgctcgatcggactgaagtt
gccgaacttactgtagaagatcctgctgaggcctttgaggatctgagagatagaaatgac
ctaaggtttctagtgaaagaggggattgaaaaagatccaatgctatatgttgatatcggg
aagggtaaacgcgggtcaaggatagaatgggagcaagctatccgtaggaagtacaagata
gcacagaggcagttcgacaggttgctggaaatgctgttatttcgacagctagacaagaga
aaccctgacagcgtcaaagcgtacagattacatgtcaaagctagactttatcgatttaat
tatgagatgctatcgcagatgaccgttgatgagagaaaggacgcgttggctaagacttat
gagtccgttgtggaggattatgaacgcatcctgaggatgaccttcggctga

DBGET integrated database retrieval system