KEGG   Cryptococcus gattii: CGB_A6470CHelp
Entry
CGB_A6470C        CDS       T02232                                 

Definition
aspartate carbamoyltransferase
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
cgi  Cryptococcus gattii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CGB_A6470C
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CGB_A6470C
Enzymes [BR:cgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CGB_A6470C
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     CGB_A6470C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1308339..1308377,1308436..1308845,1308903..1312411,1312458..1313158,1313210..1314439,1314498..1315255,1315312..1315666))
Genome map
AA seq 2333 aa AA seqDB search
MSIPTPPAFQGVVPPSDIPASQQASSLAPAAHSAVAPEVDTPNMERTPSSTPMPRPAGSL
YPPATLKGIDYQGMPDEPKWDDSMGEPDAVLELADGLALAGHSFGAKKSVAGECVFQTGM
VGYPESLTDPSYSSQILILTYPLIGNYGVPERPDVETSHVPTSEDAHNVPPASSLLDSLP
LEFESSHIHVAALVVANYHPSFSHHLASSSLGKWLQEQGIPAIWGVDTRMLTKRLREGGV
LLGRVLNKRQGVVDGERSRDGQPGVLGGVQRLINGLSTSTSLARSQSIDPFNVNWREDYE
TIPYYDPNHENLVAKVSTKTPVVYTASTGSDKKMHPQTGRQMRVVAIDVGMKWNQIRCFR
ERGIEVKVVPWNYDINNESEPYDGLFVSNGPGDPSMVKETISNLSRALETSKVPIFGICL
GHQLLALASGAKTRKMKYGNRGMNLPCTCATSGRCYITSQNHGYEVDVTTLKNGWEPLFT
NANDGSNEGIWCGKNGKPFFSVQFHPESAPGPRDTEFLFDVFIQSIVDTAREGRLISIDV
PGGELAANIAAKPREQVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKQEGIYTILVNPN
IATIQTSKGLADKVYFLPVTPEFVLKIIKHEKPDGIYCTFGGQTALNVGIKLKDEFSKLG
VKVLGTPIETIITTEDREMFARAMEEIGEKCAESATAVNLTEAIEAAERIGFPVIVRAAY
ALGGLGSGFAKDVEQLTELCGKAFATSPQVLVEKSMKGWKEIEYEVVRDCRNNCITVCNM
ENFDPLGIHTGDSIVVAPSQTLSDADYNMLRTTAVNVIRHLGVVGECNIQYALNPYSKEY
CIIEVNARLSRSSALASKATGYPLAFIAAKLGLNIPLNEIRNSVTKLTSACFEPSLDYCV
VKIPRWDLKKFNRVSTALSSSMKSVGEVMAIGRTFEETIQKAIRCIDDQLPGFGDHATIE
DLDYEIANPTDKRLFAIATALKKGYSVEKLNEMSCIDPWFLTRLQRLVKTEQVISQYNAS
NVPSALVRNAKQLGFADRQIAKMLSSNELAVRRLRIEAGITPFVKQIDTVAAEFPAFTNY
LYTTYNASEHDVDFEDNGVMVLGSGVYRIGSSVEFDWCAVRAIRTLRENGMKTVMINYNP
ETVSTDYDEADKLYFENISLETVLDIYDTEHSSGVVLSMGGQTPNNIALALHRQNVKIYG
TSPEMIDTAENRYKFSRMLDKIGVDQPLWKELTSFTEAKAFCDKVGYPVLVRPSYVLSGA
AMNVVFSQDDLNNYLTQATDVSRDHPVVISKYIEEAKEIEMDAVARDGKMVMHYISEHVE
NAGVHSGDATLVLPPQDLDAETVRKIEIATQKIGHALNVTGPYNIQFIAKNNEIKVIECN
LRAARSFPFVSKVTGVDAIEIATKVMLGLPVAPYPDVKMPANYVGVKVPQFSFSRLSGAD
PVLGVEMASTGEVACFGKDRYDAYLKALISTGIVPPKKNILLSIGSFKEKLEMLPSVHKL
HRMGYNLFATAGTADFIQEHGIPVKYLEQLGSENDLNPQKKEYSLSQHLANNLIDLYINL
PSKNRFRRPASYISQGYKSRRMAVDFAIPLITNVKNAKLFVEAIIRKPTFDISSVDYQTS
HETFTFPGLVSVQAFVPGAAEENSTDFGEATEAAIEGGFTIMQMVPQGINSAVEDEISLQ
RAQANASGAAHCDYSFSVAATADNASRLQDAIAAGAKALYIPFNNFYGANNKVSSVSQHF
AAWPADRPIITDAKATDLASILLLASLNTRSIHITSVSTKDDLLLIALAKEKGLAVTCDV
SIYALFYSQVDFPEAAKVLPTKEDQNALWDNLASIDVFSVGVLPYELGRALNKPVSARSG
VAESLPLLLTAVTEGKLTLEDISLRLSENPRAIFGLPEQSQTYVEIEVNRQSSFTAEDAE
RTWSPLDGKAIAGNIHRVVANNHSIFLDGQTFSMPFGRDVSASGPRPAKKARGSFALQKR
PSVTGLMSPISEKTSSAGGKLMSLASVAPIQEVSPVRGLVSVQTHPTFSRRHILSVKQFD
REDLHALFNVASEMRIAVERSGSVDTLRGRVLCTLFYEPSTRTSTSFEAAMKRCGGEVVQ
VNASTSSVQKGESLADTIRTVGCYADAIALRHPSVGSAKAAAKSSPVPILNAGDGIGEHP
TQSLLDVFCIREELGSVNGITVTLIGDLKNGRTVHSLVKLLSLYDVTLNFVSPRSLAMPE
SVKIEVSRAGIRFTESFTLTDEIVSKSDVLYVTRVQKERFENVAEYEAVKDIFVINNDVL
EKAKESAIVMHPLPRVNEIDPEVDFDSKRAAYFRQMRYGLFVRMALLTLVMGA
NT seq 7002 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccccacccctcccgccttccagggcgtcgttcctcccagcgacatccctgcc
tcccagcaggcttccagcttagctcctgctgctcatagcgctgtggcacccgaagttgac
actcccaacatggagcgcactccttcctctactcccatgcctaggcccgcgggcagtctt
tatccccctgctactctcaagggtattgactatcaaggtatgcctgacgagcccaagtgg
gacgactctatgggcgagcctgatgccgtccttgagcttgccgacggcctcgctctcgct
ggtcactcgttcggtgccaaaaagtctgttgccggagaatgtgtcttccagactggtatg
gtcggttatcccgagtctctcaccgatccttcatactcttctcagatccttatcctcacc
taccccttgatcggtaactatggtgttcctgagagacccgacgtagagacttctcacgtc
cccacttccgaggatgctcacaatgttcctccggcttctagccttcttgactctttgcct
cttgagtttgagtcttctcacattcacgttgctgcccttgtggttgccaactaccaccct
agcttctcacaccacttggcttcttcttctttgggcaagtggctccaagagcaaggcatc
cctgccatttggggtgtcgacactaggatgctcaccaaacgtctccgagaaggcggtgtc
ctcctcggtcgagtgctcaacaagcgacaaggtgtcgtcgacggcgagcgaagcagggat
ggccaacctggcgtactcggcggtgttcagcgtctcattaacggtctttccacttcgacg
tctttggctcgatcccagtctattgacccgttcaacgtcaactggcgagaggactatgaa
accatcccttattacgaccccaaccacgagaatcttgttgccaaggtgtctaccaagact
cctgttgtctacactgctagcactggctctgacaagaaaatgcaccctcaaaccggtagg
cagatgagggttgtggccattgatgtcggtatgaagtggaaccaaatcaggtgtttcagg
gaacgtggtattgaagtcaaggttgtcccttggaactacgacatcaacaatgagtctgag
ccttacgatggtctctttgtctctaacggtcctggtgacccttccatggtcaaggagacc
atcagcaacctttctcgagccctcgagacttctaaggtccctatctttggtatctgtctt
ggtcaccaacttctcgccctcgcttccggtgcaaagacccgcaagatgaagtacggtaac
cgtggtatgaaccttccttgtacctgcgctacatctggtcgatgctacatcacctctcag
aaccacggttacgaagtcgacgtaaccactctcaagaatggctgggaacctttgttcacc
aatgccaacgacggttctaacgagggtatctggtgcggtaagaacggcaagcccttcttc
tccgttcagttccaccccgagtctgcccctggtcctcgagacactgagttccttttcgat
gtcttcatccagagcatcgtcgacactgctcgagagggcagattgatctccattgatgtt
cccggtggtgagcttgctgccaacatcgctgccaagccccgagagcaggtcaagaaggtt
cttgtccttggttccggtggtctctccatcggacaggccggtgaattcgactactccggt
tcccaagccattaaggccttgaagcaggaaggtatttacaccatcctcgttaaccctaac
attgccactattcaaacctccaagggtcttgcggacaaggtttacttccttcccgtcacc
cccgaatttgtgctcaaaatcatcaagcacgagaagcccgatggtatctactgtactttc
ggtggtcagaccgccttgaacgtcggtatcaagctcaaggacgagttttccaaactcggt
gtcaaggtactcggtactcccatcgagaccatcatcaccaccgaagaccgagaaatgttt
gctcgcgctatggaggagattggcgagaagtgcgccgagtctgccaccgccgttaacttg
acagaggcaattgaagccgccgaacgaattggtttccccgtcattgttcgagctgcttac
gctctcggtggtttgggttctgggtttgccaaggatgtggagcaattgactgagctgtgt
ggcaaagcctttgctactagtccccaagttttggtcgagaagagtatgaagggttggaag
gagattgagtatgaagttgttagagattgcaggaacaactgtatcaccgtgtgtaacatg
gagaactttgacccccttggtatccacactggtgactctatcgtcgttgccccctcccaa
accctctctgacgcggactataacatgcttcgaaccaccgctgtcaacgttatccgacac
cttggcgttgttggagaatgtaacattcagtatgctctcaacccgtactccaaggagtac
tgcattattgaagtcaacgctcgtctctctcgttcgtccgctttggcttctaaggccacc
ggttaccctcttgccttcattgctgccaagttgggtttgaacattcctttgaacgagatc
cgaaactctgtgaccaagttgacttccgcgtgctttgagccttctctggactactgtgtt
gtcaagatccctcgatgggatctcaagaagttcaaccgagttagtactgcgttgagctcc
tccatgaagtctgtcggtgaagttatggccatcggtcgtactttcgaagagaccatccaa
aaggctatcaggtgtattgatgatcagctccctggtttcggtgaccacgccacgattgag
gatctcgactacgaaattgccaaccctaccgacaagaggttgtttgccatcgcaacggcc
ttgaagaagggctactctgtcgagaagttgaacgagatgagttgtatcgatccctggttc
ttgaccaggttgcagaggttggtcaagacggaacaggttatctctcaatacaacgcttcc
aacgttccttccgcccttgttcgcaacgcgaagcagcttggtttcgccgacagacagatc
gccaagatgctcagctccaacgagctcgccgttcgtcgtctccgtattgaggctggtatc
acccccttcgtcaagcagatcgacactgtcgccgctgagttccccgcgttcaccaactac
ctctacaccacttacaacgcctctgagcacgatgttgactttgaggacaacggtgtcatg
gtccttggttctggtgtttaccgaatcggttcttccgtcgaattcgattggtgtgctgtg
agggccatcagaacattgagggagaatggaatgaagacagtcatgatcaactacaatcct
gaaactgtgtctaccgattacgacgaggcagacaagttgtactttgagaatatctctctc
gagaccgttcttgacatttatgacactgagcactctagcggtgtcgttttgtccatgggt
ggtcagacccctaacaacattgcgctcgcacttcaccgacagaacgtcaagatctacggc
acttcacccgagatgatcgacactgccgagaaccgatacaaattctctcgaatgctcgac
aagatcggtgttgaccaacccttgtggaaggagttgacttcattcactgaggccaaggct
ttctgtgacaaggtcggctaccccgtgcttgtccgtccctcttacgttttgtctggtgcg
gcgatgaatgttgtcttctcccaagatgacctcaacaactaccttacccaggccaccgat
gtttctcgagaccaccccgttgttatctccaagtacatcgaggaggccaaggaaatcgag
atggacgctgtcgccagggatggtaagatggtgatgcactacatctctgagcacgtcgag
aacgccggtgttcactcaggtgacgctacgctcgtgcttcctcctcaggatctcgatgct
gagactgtccgaaagattgaaattgccacgcagaagattggtcatgcgctcaacgttact
ggtccttacaacattcaattcattgccaagaacaatgagatcaaggttattgagtgtaac
cttcgtgccgctcgatccttcccattcgtctccaaggtcaccggtgtcgacgccatcgag
attgccacaaaggtcatgctcggtttgcccgtcgctccctaccctgacgtcaagatgccc
gccaactacgttggtgtcaaggttcctcaattctctttcagcagattgtctggtgcggac
cctgttctcggtgttgagatggcttctactggtgaagtcgcttgtttcggcaaggacagg
tacgacgcctatttgaaggctcttatctccaccggtatcgtccctcccaagaagaacatt
ctcttgtccattggctccttcaaggagaagcttgagatgctcccttctgttcacaagctc
caccgaatgggctacaacttgtttgctaccgctggtactgccgacttcattcaagagcac
ggtatccccgtcaagtacctcgagcagcttggctctgagaacgatctcaaccctcagaag
aaggagtattctttgagccagcaccttgcaaacaacttgatcgacttgtacatcaacttg
ccttccaagaacaggttccgacggcccgccagttacatttctcagggttacaagtctagg
cgaatggccgtcgactttgctattcctctgattaccaacgtcaagaatgccaagttgttc
gttgaggccattatccgaaagcccacattcgacatctccagcgtcgactaccagacctct
cacgagactttcaccttccctggtctcgtttccgtccaagcctttgttcctggtgctgcc
gaggagaactctaccgactttggtgaggcgactgaggctgcgattgaaggtggttttacc
atcatgcagatggtaccacagggtatcaactccgctgtcgaggatgaaatctctcttcag
cgtgctcaggctaacgcttctggcgctgctcactgcgactactccttctctgttgctgct
actgccgacaatgcctctcgtttgcaagatgccatcgccgctggcgctaaagctctttac
attccctttaacaacttctatggtgcaaacaacaaggtcagcagcgtctctcaacacttt
gctgcctggcctgccgacaggcccatcatcactgatgctaaggccactgaccttgcttca
attttgttgttggccagcttgaacaccaggagcatccacattactagcgtttccaccaag
gacgacttgttgttgatcgctttggccaaggagaagggtctcgccgttacttgcgacgtt
tccatctacgctctcttctactctcaggttgacttccctgaggctgccaaggttcttccc
accaaggaggaccagaacgcattgtgggacaaccttgcttccatcgacgtcttctctgtc
ggtgttcttccttacgagctcggccgagccctcaacaagcccgtatctgcccgatctggt
gtcgccgagtctctccctctcttgcttactgccgtcaccgagggaaagcttactcttgaa
gatatctctctccgactgagtgagaaccctcgtgccatctttggcttgcccgagcaatcc
cagacttatgtcgagattgaagtgaaccgacaatcctctttcactgctgaggatgccgag
cgtacttggtcacctcttgacggcaaggccatcgcgggtaacattcaccgagtcgtcgcc
aacaaccactctatcttccttgatggccaaaccttctcgatgcccttcggccgggacgtc
tctgcctctggtcctcgacccgccaagaaagcccgcggctcgtttgctcttcagaagcga
ccttccgtcaccggtctcatgtcacctatctccgagaagacctcatccgccggtggcaag
ctcatgtcgcttgcttccgttgctcctattcaagaagtctcccctgttcgaggccttgtg
tccgttcagactcaccctactttctctcgtcgacacatcctctcagtgaagcagttcgac
cgtgaggacttgcacgccttgttcaacgtcgcttccgaaatgcgtattgcggttgagcga
tccgggtctgttgacacccttcgaggcagagttctctgcaccttgttctacgagccttca
accaggactagcacttcgttcgaggctgctatgaagaggtgtggtggtgaggttgtccaa
gtcaatgcttctacttcttctgtgcaaaaaggtgagagcttggcagacaccatccggacc
gttggctgctacgccgacgccattgctttgcgacatccttctgtgggcagcgccaaggca
gcggccaagtccagccctgtgcccatcttgaacgctggtgacggtattggagagcaccct
actcagagcttgttggatgtcttctgtatccgagaagagttgggttctgtgaacggtatc
actgttacattgattggtgatctcaagaacggccgaactgttcactcacttgtcaagctt
ctctctctttacgacgttaccctcaactttgtctctcctcgttcccttgccatgcccgaa
tctgtcaagatcgaggtttcccgagcaggtatccgattcaccgagtccttcacactcact
gatgagattgtatccaaatctgacgtcttgtacgttactcgagtgcaaaaggaacgattt
gagaatgttgcggagtatgaagccgtcaaggacatctttgttatcaacaatgatgtgttg
gagaaggctaaggagtcggcgattgtcatgcaccccttgcctagggtgaacgagattgac
cccgaagtggactttgactccaagagggcggcttactttaggcagatgcgatacggtctt
ttcgtccgaatggctcttcttactcttgtcatgggtgcttag

DBGET integrated database retrieval system