KEGG   Cryptococcus gattii: CGB_A7080CHelp
Entry
CGB_A7080C        CDS       T02232                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cgi  Cryptococcus gattii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cgi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cgi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1411514..1411613,1411689..1412025,1412077..1413247,1413306..1413541,1413599..1413692,1413755..1413911,1413960..1413967,1414014..1414058))
Genome map
AA seq 715 aa AA seqDB search
MAEQLKQVYADKKAQDQAAFVTFLTAGFPTRDATVPLMLALEAGGADIIELGVPFSDPVA
DGPVIQKANNVAIENNVHYSDCLEYVRQARAQGLKAPVLFMGYYNPIIAYGEEKAVKDAR
EAGANGYIVVDLPPTEAVDFRNTCTKAGMSYIPLVAPSTSIDRVKFLTSIADSFIYVVSK
MGVTGSSSTENISASLPELVKRIQMFTTIPLAVGFGIDNRTHFDYVTASGADAVVVGSKI
IKLIFEHADDGLAPKVVEDYCRAITLKGQNPPPLGRKNAAAPPPANGGTVSPPLPIPSGA
SLNESEVKVTAPGKLPSRFGLFGGAYVAESLVDCLNELETAYAEAKEDPAFWKEFEDMFG
YINRPSELYLADRLTEEMGGARIWLKREDLNHTGSHKINNAVGQILLAKRLGKRRIIAET
GAGQHGVATATVCAKFGMECDIFMGAEDVRRQELNVFRIKMLGGRVIPVTSGSQTLKDAV
NEALRDWVTRLDTTHYLIGSAIGPHPFPTIVRDFQRVIGREIKSQMHEKMGKLPDAVVAC
VGGGSNAIGTFYDFIEDPSVRLVGVEAGGHGIDTEAHSATLTKGVMGVVHGFSSYIIQSK
EGQLVPTHSISAGLDYNSVGPEHSHLKYSGRAEYVVADDLQCLTAFKMCTQLEGIIPALE
SSHALWGGMQLAKSLPKDKDIVICLSGNGAKDVAEVLLTLKDKEWADKLDWHVAQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagctcaagcaagtctacgcagacaaaaaggcccaggaccaagccgccttt
gtcacctttttaacagctggtttccccacccgcgatgccactgtacccctcatgcttgcc
ttagaggcaggtggtgctgacattattgaactgggtgtcccattcagtgatcctgttgcc
gacggtccagtcatccaaaaggccaacaacgttgccattgaaaacaatgttcactactct
gactgcctcgagtacgtccgacaggctcgtgcccagggtctcaaggctcccgtcttgttc
atgggctactacaaccccatcatcgcttatggcgaggaaaaggccgtcaaggatgcccga
gaggccggtgccaacggctacatcgtcgtcgacttgccccccaccgaagccgtcgacttt
agaaacacctgtaccaaggctggcatgtcttacatccccctcgtcgccccttctaccagc
atcgaccgagtcaagttcttgacttctatcgccgattctttcatctatgtggtctccaag
atgggtgtcaccggttcttcctctaccgaaaacatttcagcttccctccctgaactcgtc
aagcgtatccaaatgttcaccaccatccctctcgctgtcggttttggtattgacaaccgt
acccactttgactatgttacagcttccggtgctgatgccgttgtcgttggatccaaaatc
atcaagctcatctttgagcacgccgatgacggtcttgctcccaaagtcgtcgaagactat
tgccgagcaatcactctcaagggccagaaccctccccctcttggccgaaagaatgctgct
gcccctcctcctgccaatgggggtaccgtctcccctcccctccccattccctctggcgca
tcccttaacgagtccgaagtcaaggtcaccgcccccggtaaacttccttctcgattcggc
cttttcggtggtgcctatgtcgctgaatcgcttgttgactgtttgaacgagcttgaaact
gcctatgccgaggccaaggaggaccctgcgttctggaaagagtttgaggatatgtttggt
tacatcaacagacctagtgaactttaccttgccgacaggttgaccgaggagatgggcggt
gccaggatttggctcaagagggaagatctcaaccacactggttcacacaaaattaacaat
gccgttggccaaattctcctcgccaagcgattgggtaagcgaagaattatcgccgagacg
ggtgccggtcagcacggtgtcgctactgccaccgtctgcgccaagtttggcatggaatgt
gatattttcatgggtgcagaggatgtgaggaggcaagagttgaacgttttcaggatcaag
atgcttggtggccgtgttatccccgtcacgtctggttcccagaccttgaaggacgctgtc
aacgaggctttgagagattgggtcactcgattggacactacgcattacctcattggctcc
gccatcggtccccaccccttccccaccattgtccgtgacttccaaagggttattggtcga
gagatcaagtcgcagatgcacgaaaagatgggcaagttgcctgatgcagtcgttgcctgt
gtcggtggtggctccaacgccatcggtactttttacgactttatcgaggatcccagcgtg
agattggtcggtgttgaagccggtggccatggtattgacactgaggcacactctgctaca
ttgaccaagggtgtcatgggtgtcgtccacggtttctcttcttacattatccaatcaaag
gaaggtcagctcgtccccacgcactccatctctgccggtctcgactacaactctgtcggt
cccgaacactctcacctcaagtatagcggtcgagccgaatatgtcgtggcggacgatttg
cagtgtcttacggcgttcaagatgtgtacccagttggaaggtattattcctgctttggag
agcagtcatgctctctggggtggtatgcagttggccaagagtttgcccaaggataaggat
attgtcatctgtttgagtggaaacggtgccaaggacgttgcagaggtgctgttgacgttg
aaggacaaggagtgggcggacaagcttgactggcacgttgcgcagtag

DBGET integrated database retrieval system