KEGG   Cryptococcus gattii: CGB_A7080CHelp
Entry
CGB_A7080C        CDS       T02232                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cgi  Cryptococcus gattii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGB_A7080C
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGB_A7080C
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGB_A7080C
Enzymes [BR:cgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CGB_A7080C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1411514..1411613,1411689..1412025,1412077..1413247,1413306..1413541,1413599..1413692,1413755..1413911,1413960..1413967,1414014..1414058))
Genome map
AA seq 715 aa AA seqDB search
MAEQLKQVYADKKAQDQAAFVTFLTAGFPTRDATVPLMLALEAGGADIIELGVPFSDPVA
DGPVIQKANNVAIENNVHYSDCLEYVRQARAQGLKAPVLFMGYYNPIIAYGEEKAVKDAR
EAGANGYIVVDLPPTEAVDFRNTCTKAGMSYIPLVAPSTSIDRVKFLTSIADSFIYVVSK
MGVTGSSSTENISASLPELVKRIQMFTTIPLAVGFGIDNRTHFDYVTASGADAVVVGSKI
IKLIFEHADDGLAPKVVEDYCRAITLKGQNPPPLGRKNAAAPPPANGGTVSPPLPIPSGA
SLNESEVKVTAPGKLPSRFGLFGGAYVAESLVDCLNELETAYAEAKEDPAFWKEFEDMFG
YINRPSELYLADRLTEEMGGARIWLKREDLNHTGSHKINNAVGQILLAKRLGKRRIIAET
GAGQHGVATATVCAKFGMECDIFMGAEDVRRQELNVFRIKMLGGRVIPVTSGSQTLKDAV
NEALRDWVTRLDTTHYLIGSAIGPHPFPTIVRDFQRVIGREIKSQMHEKMGKLPDAVVAC
VGGGSNAIGTFYDFIEDPSVRLVGVEAGGHGIDTEAHSATLTKGVMGVVHGFSSYIIQSK
EGQLVPTHSISAGLDYNSVGPEHSHLKYSGRAEYVVADDLQCLTAFKMCTQLEGIIPALE
SSHALWGGMQLAKSLPKDKDIVICLSGNGAKDVAEVLLTLKDKEWADKLDWHVAQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagctcaagcaagtctacgcagacaaaaaggcccaggaccaagccgccttt
gtcacctttttaacagctggtttccccacccgcgatgccactgtacccctcatgcttgcc
ttagaggcaggtggtgctgacattattgaactgggtgtcccattcagtgatcctgttgcc
gacggtccagtcatccaaaaggccaacaacgttgccattgaaaacaatgttcactactct
gactgcctcgagtacgtccgacaggctcgtgcccagggtctcaaggctcccgtcttgttc
atgggctactacaaccccatcatcgcttatggcgaggaaaaggccgtcaaggatgcccga
gaggccggtgccaacggctacatcgtcgtcgacttgccccccaccgaagccgtcgacttt
agaaacacctgtaccaaggctggcatgtcttacatccccctcgtcgccccttctaccagc
atcgaccgagtcaagttcttgacttctatcgccgattctttcatctatgtggtctccaag
atgggtgtcaccggttcttcctctaccgaaaacatttcagcttccctccctgaactcgtc
aagcgtatccaaatgttcaccaccatccctctcgctgtcggttttggtattgacaaccgt
acccactttgactatgttacagcttccggtgctgatgccgttgtcgttggatccaaaatc
atcaagctcatctttgagcacgccgatgacggtcttgctcccaaagtcgtcgaagactat
tgccgagcaatcactctcaagggccagaaccctccccctcttggccgaaagaatgctgct
gcccctcctcctgccaatgggggtaccgtctcccctcccctccccattccctctggcgca
tcccttaacgagtccgaagtcaaggtcaccgcccccggtaaacttccttctcgattcggc
cttttcggtggtgcctatgtcgctgaatcgcttgttgactgtttgaacgagcttgaaact
gcctatgccgaggccaaggaggaccctgcgttctggaaagagtttgaggatatgtttggt
tacatcaacagacctagtgaactttaccttgccgacaggttgaccgaggagatgggcggt
gccaggatttggctcaagagggaagatctcaaccacactggttcacacaaaattaacaat
gccgttggccaaattctcctcgccaagcgattgggtaagcgaagaattatcgccgagacg
ggtgccggtcagcacggtgtcgctactgccaccgtctgcgccaagtttggcatggaatgt
gatattttcatgggtgcagaggatgtgaggaggcaagagttgaacgttttcaggatcaag
atgcttggtggccgtgttatccccgtcacgtctggttcccagaccttgaaggacgctgtc
aacgaggctttgagagattgggtcactcgattggacactacgcattacctcattggctcc
gccatcggtccccaccccttccccaccattgtccgtgacttccaaagggttattggtcga
gagatcaagtcgcagatgcacgaaaagatgggcaagttgcctgatgcagtcgttgcctgt
gtcggtggtggctccaacgccatcggtactttttacgactttatcgaggatcccagcgtg
agattggtcggtgttgaagccggtggccatggtattgacactgaggcacactctgctaca
ttgaccaagggtgtcatgggtgtcgtccacggtttctcttcttacattatccaatcaaag
gaaggtcagctcgtccccacgcactccatctctgccggtctcgactacaactctgtcggt
cccgaacactctcacctcaagtatagcggtcgagccgaatatgtcgtggcggacgatttg
cagtgtcttacggcgttcaagatgtgtacccagttggaaggtattattcctgctttggag
agcagtcatgctctctggggtggtatgcagttggccaagagtttgcccaaggataaggat
attgtcatctgtttgagtggaaacggtgccaaggacgttgcagaggtgctgttgacgttg
aaggacaaggagtgggcggacaagcttgactggcacgttgcgcagtag

DBGET integrated database retrieval system