KEGG   Cryptococcus gattii: CGB_A7180CHelp
Entry
CGB_A7180C        CDS       T02232                                 

Definition
histone deacetylase
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CGB_A7180C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1436868..1437716,1437769..1437966,1438032..1438239,1438316..1438377,1438498..1438703,1438756..1438796,1438853..1439031,1439106..1439642))
Genome map
AA seq 759 aa AA seqDB search
MAASECPLGLYVQPACLQHRYIRHTNASHIFERPERLRAVLLGVAAAVARLEQRNTADDL
ASLLSSLSLVSPAQPTAHLHLVPAPPLPPTPGNILLHHPAVQLAHSPVPDAPFPYIGPPS
TGPSGASFPSSSYLRDLVKWSNGAVDRIKQTGCEIPEGLGLNPGDLYLGPGSIIAIEGAI
QTVCQAVDHVVRKPKPVSIKEEEPSTPPVEGPADGPLFTKAFCAIRPPGHHCGEDAPSGF
CYVNNVVIGALHGYLQHDIDRAIIIDFDLHHGNGTQALVMPLNAASYADDIQVKAGKPPI
IGQGGRRRRGWKGFYGSVHDIDGDLDLIRDASISLAAHGQYIENIHLKPYTSEADFYERI
YPLYLALLDKAKVFMEETEANPERTIVFISAGFDACEWEHQGMQRHDRRVPVSFYSRYTR
DIAAFADKYTEGKVVSVLEGGYSDRALTSAAMGHIVGMRGSLPEGCDEWWTERELINLEK
ATKKKRGGKLAPLPAEFATQPHLSRTHSLLAHFEGVTSTESVASTATNTPMGTRMTLRDR
RRADEAGRASVESTPGSGGAKRGKGRAVAAVVGTPATSKLKTSSHPIPTDTSSVEPETNT
VAPSHNYTPLTDKTLETTQSSLEKSVRREKEMGDWIEEAVKDITKMSLEEHASTPVPEHE
FKSQSSPPLSQTPTTTTTTTALLPKIILRIPARPTIDNTAEQPHPIPPPSSQSDQQPPLD
TEQPPLDIETQARTPSSEAVTYNSTATAAELLNHIAGGH
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagcgagtgccctcttgggctgtacgtgcagccggcgtgtctccagcacaga
tacatccgccatacaaacgcatcccacatattcgagcgtccagagcgactccgcgcagtg
ctcctcggcgtcgctgctgcagtcgccaggctcgagcagcgcaacactgcagacgatctc
gccagcctcctctcctccctgtccctcgtatcccctgcccagcccacagcccacctccac
ctcgtgcccgccccgcccctcccgcccacgcccggcaacatcctcctgcaccatcccgca
gtccagctcgcccactccccagtccccgacgccccttttccatacatcggcccaccgtcc
acaggcccttctggcgcaagtttcccgtcgtccagctatctcagggatctggtcaagtgg
tccaacggggcggtggacaggatcaagcaaacgggatgcgagataccagagggactggga
ctgaaccctggagatctttatctcggccctggaagtatcattgccatcgagggcgctatt
caaacagtttgtcaagcggtagatcatgtagtgcggaaaccaaaaccggtatccatcaaa
gaagaggagccgtctacaccccctgtggaaggtcctgcagatgggccattgttcacgaaa
gcgttttgtgcgataagaccaccaggtcatcactgtggtgaagatgcaccctctgggttt
tgctatgtcaacaacgtggtcattggcgccctgcatggctacctccaacacgacattgat
cgcgcaatcatcattgatttcgatctgcaccacggtaacggcacgcaagcgctcgttatg
cctctcaacgcggcttcctatgcggatgatatccaggtcaaggcgggaaagccaccgatc
attggacaaggagggagaagaagaagaggttggaaggggttctatggatcagtgcatgat
attgatggcgatcttgatctcattcgagacgcctccatctctctcgctgctcatggacaa
tacatcgaaaatatccatcttaaaccatacacctctgaagccgatttctacgaacgaatc
tatcctctctatcttgcgctcttggacaaggccaaggtatttatggaagagactgaagcg
aacccagagagaacgattgttttcataagtgcaggattcgatgcttgtgaatgggaacat
caaggaatgcagcggcatgatcgacgagtacccgtttcgttctattcaaggtatacgcgt
gatattgcagcttttgcggacaagtacaccgagggcaaggttgtctccgttttagaaggc
ggttacagcgatcgcgctttgacaagtgcggccatgggtcatattgtgggaatgagaggg
tcgttgcctgaaggatgtgatgagtggtggacagaaagagagctgattaatttggaaaag
gcaacgaaaaagaagagaggaggtaaacttgcccctcttccagcagagtttgccacacaa
ccccatctctctcgaacacactctctccttgcccattttgaaggggtgacttcaacagag
tcagtcgcaagtacagctacaaatacgcccatggggacaagaatgaccttgcgcgataga
agaagggcggatgaggctggtagagcgagtgtagagagtacacctggttccggtggggcg
aaaaggggcaagggaagggcggtagcggcggtggtggggacaccggcaacatccaagctc
aagacatcctcgcaccccattcccacagatacatcctctgtggagccagaaactaacaca
gtagctccttcgcacaactatacaccattaacggataaaacgctcgaaacaacacaatct
tcgttggaaaagagtgtaaggagagaaaaagaaatgggagactggattgaagaagctgtc
aaagacattacaaaaatgtctctggaagagcatgcatccacaccggtaccggaacacgaa
ttcaagtcccagtcgtccccgcctttatcacaaactccaacgaccacgaccacgacgacg
gctttactacccaaaattatcctccgtattcccgcacgcccaactatcgataatactgcc
gagcaacctcaccccatcccaccaccctcatcacagtcggaccaacaaccccctctcgat
accgaacaaccccctcttgatatcgaaacacaagctcgaaccccatcttccgaggctgtt
acatacaactctacagcgaccgccgccgagcttttaaatcacattgccggcggtcactag

DBGET integrated database retrieval system