KEGG   Cryptococcus gattii: CGB_A8040WHelp
Entry
CGB_A8040W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
cgi  Cryptococcus gattii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CGB_A8040W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:join(1593464..1593488,1593626..1593657,1593736..1593879,1594078..1594108,1594176..1594249,1594305..1594313)
Genome map
AA seq 104 aa AA seqDB search
MAGDTYTPGDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAAN
VNKGVTWYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEATK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacacttacactcctggtgacgcttctaagggtgctggtatcttcaagacc
cgatgcgctcaatgtcacacccttggtgctggtgagccccacaaggtcggccctaacctt
cacggtctcattggccgaaagtccggtcaggctgagggtttctcttacaccgccgccaac
gtcaacaagggtgttacttggtaccttgaaaaccccaagaagtacattcctggtaccaag
atggcgttcgccggtctcaagaaggctaaggacaggaacgacctcgttgcccaccttgag
gaggctaccaagtaa

DBGET integrated database retrieval system