KEGG   Cryptococcus gattii: CGB_A8040WHelp
Entry
CGB_A8040W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
cgi  Cryptococcus gattii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 10188575
NCBI-ProteinID: XP_003191678
UniProt: E6QYH0
Position
A:join(1593464..1593488,1593626..1593657,1593736..1593879,1594078..1594108,1594176..1594249,1594305..1594313)
Genome map
AA seq 104 aa AA seqDB search
MAGDTYTPGDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAAN
VNKGVTWYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEATK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacacttacactcctggtgacgcttctaagggtgctggtatcttcaagacc
cgatgcgctcaatgtcacacccttggtgctggtgagccccacaaggtcggccctaacctt
cacggtctcattggccgaaagtccggtcaggctgagggtttctcttacaccgccgccaac
gtcaacaagggtgttacttggtaccttgaaaaccccaagaagtacattcctggtaccaag
atggcgttcgccggtctcaagaaggctaaggacaggaacgacctcgttgcccaccttgag
gaggctaccaagtaa

DBGET integrated database retrieval system