KEGG   Cryptococcus gattii: CGB_A8460WHelp
Entry
CGB_A8460W        CDS       T02232                                 

Definition
ubiquitin-specific protease
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cgi04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:join(1713805..1714098,1714150..1715648,1715704..1716130,1716201..1716847,1716904..1716971,1717035..1717168,1717228..1717515,1717572..1717699,1717755..1718074,1718143..1718225,1718295..1718314,1718373..1718397)
Genome map
AA seq 1310 aa AA seqDB search
MTRPPSPPSFAGLQLSQLLQYASDDNGTGHYPPKVWFERACYNADKAKLAERKQSKEDMF
VSYSRACQSYVNVAMHNDWPDVKKKDPQLAARVKDFKPMYDSFVAKAKALKEELRQAEAS
SSAQPKSESSKPPVSRQRSGPEITSIGNIRDRMQALAGHGMEVGTVQSKRLSREAPAKAS
KPAALSSMTSSAARSRSGSESRPSPTTTTNGRQIVVTASSKPPPTPSQEKPPPSAPVSVQ
ATGSSSRSRRSTLTSEGQGLSASIGSAAASPAQSPMPTPAAGPSRSPLPSIPSSPQPLPA
SHRPLPSPEPPRSSVPIKSSDMESRPEDGLAEFERAFPSLSEFGKQWDGDSLQSDSNSHD
MNHTPKYPKPPTQPPISEEDTIPGLPYLPSVPISKPGLPPPPSRPDVSAFSPPSASSSAQ
TLGQPPVPRGLSPPKPDVGSGVGLHRPASTPMPNIAGLDLLDMPDGDVAQVKAMNGGGKL
EALNFPETISSLPQYSPTPSHPTPITGHPLPQPPSHPPVSEPAQPAPKPKEKPKFPFSNS
ITPDELREYFLSPSVEMLFLDIRPEDEWKKGYVGKEYEKRGARVEVVWLDPTVLLRDGMT
ASKLEDALSLSPVVQREAFQNRHKYDLVIVYDARSPVWPKEGPLSRLWDMLFMGLDEKRL
QRNPVILVGGYEKWREFIKMRAARHAHPAKGKDVKNGLNGYTMMRSDVASPAPSEVSVKK
ANREAPVYQASQYAKSIAENFGAGPQSMTGDSYRPSTHSHSQSQPYTPTYRHHHSRTGST
YSFHGAIAAPPQASIHPGPGARRRSDYIEHTGQSYSGSTATSPSIQSTSTTPQPQQQYYT
SPPLPASNSMTPSISSMASPRASIDYPQAHALAKVPVPMPPPAVARPMERHDAYTSAHAQ
SLVPTVSGYGKLPPQGQVTRSQAMRGMDIVSAGGKDKVGYWRDVVLGITGLKNLGNTCYM
NSTIQCLSATYPFSTFFLDGTFSRSINKENPLGTKGELAKAWAELLRVLWSEKYEFLSPM
TFRKQITHFAPQFLGSDQHDSQEFLSFVLDGLHEDLNRIKRKPPPVEMTPEREAMLESAP
PEVASEREWAIYRQRNDSLIVDLFQGQYRNRLECLTCHKTSTTYDAFMYMSLPVPSGKTK
VVIQELIDEFVKAEVMEKENAWYCPRCKTNRRASKTLTIARLPPVLLIQLKRFTTRDGLF
WDKSETPVIFPIRGLDLTRYLPGPAGSSVGSGRQVGPDGTFDPRAQVGPFKYDLYGVSNH
MGTLSSGHYTAFVKSKEGWKYCEDSQVMPAQEKDVISRPAYILFYKRVPG
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atgactcggccgccatctccaccgtccttcgcagggctccagctctcacagctactgcag
tacgcctcagacgacaatggcacaggtcactacccacccaaagtatggttcgaacgcgca
tgctacaacgccgacaaggcaaagttggcagagcgcaagcagagcaaagaggacatgttc
gtcagctacagcagggcgtgccagtcctatgtgaatgttgcaatgcacaacgattggcca
gacgtcaagaaaaaggatcctcagttggccgccagagtcaaggatttcaagccgatgtac
gattcattcgtcgcaaaagccaaggctttgaaagaagaacttcgacaggcggaggcatct
tcatccgctcagcccaaatcagaatcatcaaaaccacctgtatcaagacaacgatctggg
cctgaaataacatcaatcggcaatatcagagatcgaatgcaggcactcgccggacacgga
atggaggttgggactgttcaatcgaagcgcttgagtagagaggcgccggccaaagcttcc
aaacctgctgcattgagtagtatgaccagttcggcggcaaggtcaagaagtggtagtgaa
tcgcggccttcgcccacaacaacgaccaatggccggcaaattgtggtcaccgcttcatcc
aaaccaccgccaactccgtcacaagagaaaccacctccatctgcacctgtcagcgtgcaa
gccactggatcgtccagcaggtcacggcgatctaccttgacgagtgaaggccagggctta
agcgcatctattgggtctgcagcagcttcgccggcacaatcaccgatgcccacacctgca
gctggcccgtccagatcgcctttgccctccatcccatcctctcctcaaccccttccagcg
tctcatcggccattaccctctcccgagccaccacgatcaagtgtccctatcaagtcatcc
gacatggagtctcgtcctgaagacggcctggcagagtttgaacgtgcttttccatctctc
tcagagtttggaaaacaatgggatggtgattcactacagtcagattcgaatagtcatgat
atgaaccacaccccaaagtacccgaaacctccaacgcaacctccgatttctgaagaagac
actatcccaggcctcccatatttaccttctgttccgatatccaagcccggcctcccccct
cctccctctcgaccggacgtatctgcattctcaccaccatctgcttcctcatccgcgcaa
actctgggacaacctcccgtcccccgcggactatcacctcccaaacccgacgttggctcg
ggtgtgggtctacatcgaccagccagtacacccatgcccaatattgctggtttagatctg
ctggatatgcctgatggggatgtagcacaagtaaaagctatgaatggcggtggaaaactg
gaagccttgaatttccctgagaccatatctagccttccacaatattctcccactccatcc
caccctactccaatcacaggacatcctctcccccaaccaccttctcatcctcccgtttct
gagcccgcgcagcctgctccaaagcccaaggagaaaccaaagtttccatttagtaattct
atcactccggatgaacttcgcgaatactttcttagcccttcagtggagatgttgttcttg
gacataaggccggaagatgagtggaagaagggatatgtagggaaggagtatgaaaagagg
ggtgcgagggtggaggttgtgtggctagatccgacagtcttacttcgtgatggaatgacg
gcgagcaaactggaagacgcactttccctctctcccgttgtccaacgcgaagctttccag
aatcgacacaaatatgacctcgtcatagtctacgacgctcgttcccccgtatggcccaag
gagggtcctctaagccgattgtgggacatgctattcatgggcctcgatgagaagcgtttg
cagagaaaccctgtcattttggtaggaggttatgaaaagtggagagagtttatcaaaatg
cgggcggcgaggcatgcacatccggcaaaggggaaagatgtgaagaatgggctgaatggg
tacacgatgatgcgatcggatgtcgcgtctcctgctccttccgaggttagtgtcaagaag
gcgaacagggaagcaccggtctaccaggcatcgcagtatgcgaagagtatcgctgaaaac
tttggcgccggtcctcaatctatgacgggagactcttaccgtccgtccacccattctcac
tcccaatcgcaaccctacacgcccacataccggcatcaccactccagaacgggctcaaca
tactctttccacggggctattgccgctcctccacaagcttccattcaccccggaccaggt
gccagacggcgaagcgactatattgaacatacaggtcaatcatactctggctcaactgcg
acttcaccctccatacaatcaacaagcacaacaccccaacctcaacagcaatactacact
tccccacccctccctgcttccaactccatgacaccgtccatatcatccatggcctctccg
cgggcatcgatcgattaccctcaggcgcatgcattggcaaaagtaccagtcccaatgcct
cctccagccgtagcgaggccgatggaacgacatgatgcttacaccagcgcacatgcgcaa
agtttggtaccgactgtttccggttatggtaaacttccgccccaaggccaggtgaccagg
agtcaagcaatgagggggatggacattgtgtctgctggtgggaaggataaagtggggtat
tggcgggatgtggtgttaggtattactgggttgaagaatcttggaaatacttgctatatg
aactcgacaatacaatgtctcagtgcgacttacccattctctacgtttttccttgatggg
accttttctcgttcaataaataaagaaaatcccttggggaccaaaggcgagttggccaag
gcatgggcagaactgctgagagtattgtggagtgagaaatatgagttcttatctcctatg
actttccggaaacaaattacgcactttgccccccagtttcttggttctgatcaacatgac
tctcaagagttcttgtcattcgtccttgacggcttacatgaagaccttaaccgaatcaag
cgcaaacccccacctgtggagatgactcccgaaagagaggcgatgctggaaagcgcccca
ccagaagtggcttctgagagagaatgggcgatttacagacagaggaatgatagtttgatt
gtggatctgttccaggggcagtataggaataggttggagtgtttgacctgtcacaaaaca
tcgacgacttatgatgcgttcatgtatatgtctctgcctgttccatcgggtaaaacaaag
gtggtcatacaagaacttattgacgaattcgtcaaggcggaagtgatggaaaaggagaac
gcctggtactgccctcgctgcaaaaccaaccgtcgtgcttccaaaacactaacaatcgct
cgtcttccacctgtactgctcatccaactcaaacgattcacaacgagagacggtctcttc
tgggacaagtccgagacaccggtcatcttccccatcagaggtttagatcttacacggtac
ttacccggacctgcaggttcgtcagtaggaagtggaaggcaggtggggcccgatgggacg
tttgatccgagagctcaggtggggcctttcaaatatgatttatatggtgtaagcaatcat
atggggactctcagttcaggacattatacggctttcgtgaagagtaaagaaggttggaag
tattgtgaggatagtcaggtgatgccggcacaggagaaggacgtaatttcccgaccagcc
tatatcctgttctataaacgagtacctggataa

DBGET integrated database retrieval system