KEGG   Cryptococcus gattii: CGB_A9150CHelp
Entry
CGB_A9150C        CDS       T02232                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGB_A9150C
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_A9150C
   00620 Pyruvate metabolism
    CGB_A9150C
   00640 Propanoate metabolism
    CGB_A9150C
  Energy metabolism
   00680 Methane metabolism
    CGB_A9150C
Enzymes [BR:cgi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CGB_A9150C
Lipid biosynthesis proteins [BR:cgi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CGB_A9150C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(1835352..1835380,1835438..1835570,1835629..1836645,1836696..1836877,1836925..1836965,1837017..1837163,1837227..1837430,1837487..1837776))
Genome map
AA seq 680 aa AA seqDB search
MGKTEVAPGVHHVHPLPDSVPESEDLYAPPPRMQGKDGRPKPHVGPNYEAYVKEWAKTVG
PNSDEWWAAKARETLDWYEDFKTVRAGGFEHGDVQWFPEGTLNAAYNCLDRHYYKNPKKT
AIIYEADEPSESREVSYEELMQETCRVANVLKSYGVKKGDAVSIYLPMTWQAAAAFLACA
RIGAIHSAVFAGFSAESLRDRVNDCECKVLITTDEGRRGGKSIATKQIVDAALQQCPLVE
HVLVLRRTGSKVPMTEGRDKWWDEECAKMLAYCPCERMASEDPLFILYTSGSTGMPKGVV
HCTGGYLLGAALSLKYVFDTHADDRFACMADIGWITGHSYIIYGPLANGITTTVFESTPV
YPTPSRYWDFVDKWKATQLYTAPTAIRLLRRMGEEHVKDHDLSSLRVLGSVGEPINPEAW
HWYNDFAGKNQCAIVDTYWMTETGSFSIAPLPGAISTKPGSATFPFFGMDVDIIDPQSGQ
TLEGNDVEGVLVAKKPWPSLARTVYRDHKRYLETYMKPYPGYFFFGDGAARDYDGYMWIK
GRVDDVINVSGHRLSTAEVESALILHKGVAETAVVGCADDLTGQAVYAFVTMKPQFDLKA
TKEADLSKELAIQVRKVIGPFAAPKKIYLVSDLPKTRSGKIMRRVLRKIVAGEGDQLGDL
SSIADPQIVDEVKQKVSSSA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacagaagtcgctcccggtgtccaccacgttcaccctctccccgactccgtt
cccgagtcggaggacctctacgctccccctccccgtatgcagggcaaggacggtcgtccg
aagccgcatgttggtccgaactacgaggcctacgtcaaagaatgggcaaagactgttggc
cccaatagtgatgagtggtgggccgcaaaggccagggaaactcttgattggtatgaggac
tttaagactgtcagggccggtggctttgagcatggcgatgttcaatggttccctgaaggt
accttgaacgctgcctacaactgtctcgaccgacactactacaagaaccccaaaaagacc
gccatcatctacgaggccgacgagccctccgagtcccgtgaagtctcttacgaggaactc
atgcaggagacttgccgagttgccaacgtcctcaagagttacggtgtcaaaaagggtgac
gctgtgtccatctatctccctatgacttggcaggccgctgcagcattccttgcttgcgcc
aggattggtgctatccactctgctgtctttgccggttttagcgccgaaagtttgagggat
cgggttaacgattgtgaatgcaaggttttgatcaccaccgacgagggtcgacgaggcggt
aagagcattgctaccaagcagatcgtcgatgctgctctccagcagtgccctcttgttgag
cacgttcttgttcttcgacgaactggcagcaaggttcccatgactgagggacgtgacaaa
tggtgggacgaagaatgtgctaaaatgctcgcttactgcccttgcgagagaatggcttcc
gaggacccgctcttcatcctctacacctctggttccactggtatgcctaaaggtgttgtc
cactgcactggtggttacctcctcggtgccgccctctccctcaaatacgtctttgacacc
cacgccgacgaccgatttgcctgtatggccgatattggatggattaccgggcacagttac
atcatttacggccctctcgccaacggcatcacgaccaccgtctttgaatccacccctgtc
taccccacaccatccagatactgggactttgtcgacaagtggaaggctactcagctctac
actgcgcccactgctatccgattgttaagacgtatgggcgaagagcacgtcaaggaccac
gatctcagctctcttcgagttttgggctctgtcggtgagcccatcaaccccgaggcttgg
cattggtacaatgactttgcgggcaagaaccaatgtgctattgttgacacttactggatg
accgagactggttctttctcgattgctcctctccccggagccatctccaccaagcccggt
tctgccaccttccccttcttcggtatggatgttgacattattgaccctcaaagcggtcag
accttggagggtaacgatgttgagggtgttctcgttgccaagaaaccatggcccagtctt
gccaggactgtctacagggaccacaagaggtaccttgagacttacatgaagccttacccc
ggctacttcttctttggtgacggtgctgctcgagactatgacggctatatgtggatcaag
ggacgagttgatgatgttatcaacgtctctggtcaccgactttccacagccgaggtcgaa
tctgcgcttatccttcacaagggtgtcgcagagactgccgtcgttggatgtgctgatgat
cttaccggtcaggccgtctacgctttcgttaccatgaagccccagtttgacttaaaggct
accaaggaggccgatctcagcaaagagttggctatccaggtaaggaaggttattggtcca
ttcgctgcccccaagaagatttacctcgtctccgatctcccgaagacccgatcaggaaag
attatgcgtcgagttctccgaaagattgttgctggcgagggcgaccaattgggagatctt
tcttccattgcggacccccaaattgtcgatgaagtcaagcaaaaagttagcagctctgct
tga

DBGET integrated database retrieval system