KEGG   Cryptococcus gattii: CGB_B0390CHelp
Entry
CGB_B0390C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cgi  Cryptococcus gattii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(join(111774..111869,112000..112087,112153..112444,112501..112593,112676..113115,113173..113243,113457..113650,113709..113781))
Genome map
AA seq 448 aa AA seqDB search
MSRFKISGALWDKIHHYSSFPQTGVSLQQMIHFGHNPTPGTLLKASQFLSEELPIRLSHR
VVELNALPDGLAKMPSINKVKEWYAQSFEELVTFPKPRFKPELEGIFNAPNSDRTKLAFP
SSTPNPSLNPLMDDGPVSSGLLMERQNHGSGNGNGNGNGKGGGNGNGNGQRLRIPMERRY
YSPPPATIVYPPEVHDYNERFTHLLENIKKRHDPTVTTVAQGVLEWKKKRKAGRIGVPIQ
EWLDRFYMSRIGIRFLIGQHIALNTLQPHPDYVGIICTRANVHDICHEAIENARYVCEEH
YGLFKGPPIQLLCPKDLTFPYVPGHLSHICFELLKNSLRAVVERFGVDNEDAFPPIKVVV
VEGSEDITIKISDEGGGIPRSAIPMIWTYLYTTMSDEGLEATIEQSDFKAPMAGFGYYAR
FFGGDLRLISMDGYGTDVYISLNKLSSR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgattcaaaatttcaggcgccctctgggacaaaatccatcactactcatctttt
ccacagaccggggtttccctccaacaaatgattcatttcggtcataatcccacacccggt
acactcctcaaagcttcccagtttctttctgaagaactgcctatcagattatcacatagg
gtggtagagctcaacgccctaccagatggactggctaagatgcctagtatcaataaggtg
aaggaatggtatgcccaaagctttgaggaacttgttacgtttccaaaacctagattcaaa
ccagaacttgaaggtatattcaatgccccaaattcagaccgaacaaaattagctttcccc
agctctactccaaacccttctctgaacccacttatggacgacggcccggtcagttctggt
cttttgatggagagacagaaccacggaagtgggaacgggaacggtaatggaaatggcaag
ggaggtggaaacggcaatggtaacgggcagagattacggatacccatggaacgtcggtac
tactcaccaccacctgcaacaatcgtctacccaccggaagtacatgactacaatgaaagg
tttacccatctacttgagaatatcaagaaaagacacgatccgactgtcacaaccgttgct
caaggtgtattggaatggaagaagaagcgaaaagcgggaaggataggagtaccgatacaa
gagtggctggataggttctacatgagccgaattggtattcggttcttgataggacaacac
attgcgctcaacactttacaacctcatcctgattatgtggggataatttgcacacgagcc
aacgtacatgatatatgtcatgaagcgattgaaaacgcccgatatgtctgtgaagagcac
tacggtctcttcaaaggtccgcctatccaactcctttgccctaaagacctcacattccca
tacgtgcccggccacctctcccacatttgctttgaactcttgaaaaactcccttcgtgct
gttgtggagcgtttcggggtggataacgaggacgctttccccccaattaaggtggttgtg
gttgagggtagcgaggatatcactatcaagatttcggatgaaggtgggggaattcccaga
agtgcgattcccatgatctggacgtacctctacaccacaatgagtgacgaaggtttggaa
gcgaccattgaacagtcagacttcaaagcccccatggctggtttcgggtactatgctaga
ttttttggtggtgatctcagattgatctcgatggacgggtatgggacggacgtgtatatc
tctctcaataagttatcttccaggtga

DBGET integrated database retrieval system