KEGG   Cryptococcus gattii: CGB_B0650WHelp
Entry
CGB_B0650W        CDS       T02232                                 

Definition
disulfide-isomerase precursor
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cgi  Cryptococcus gattii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cgi04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(173972..174070,174130..174164,174296..174318,174371..174411,174469..174550,174604..174682,174744..174882,174953..175177,175250..175509,175582..175825)
Genome map
AA seq 408 aa AA seqDB search
MRLSISISAALLAFTSLVSASNVVDLDTTNFDQIIGQDKGALVELWCGHCKNLAPTYERL
ADAFPSNKVIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLETLAAF
VTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKDVLVAFTAPWCGHCKNMKPAYEKV
AKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFPTIKFFPKGSKDPVAYDSGRTAEQFV
DWINDKSGTHRSVSGLLSETAGRVLTLDNLASEFFSANVPERSEIVKKAQEAVTTLDKKS
RATADYYIKAMERITAKGEEWLAKEQARLANLLASSSLAPTKLDELKVKINILSAFAAQK
AGEAYDSAEEILEGAWDSAKQIPIQAKDGLDQFADAVEEKAKRIRSDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcagtatctcaatctcagcggcacttcttgcttttacctctttggtgtccgcc
agcaacgtcgtggatctcgacactactaactttgaccaaattattggacaggataagggt
gcccttgtcgaattatggtgtggacactgcaagaacctcgctcctacttatgagcgtctt
gctgacgctttcccttctaacaaggttatcatcgccaagactgatgctgacggtgtcgga
cgggaactcggttctcgattcggtgtctctggtttccccactctcaaatggttccctgct
ggctcccttgagcccataccttacagcggagctcgagaccttgaaacccttgctgcattc
gttacaaagcaatctggcgtcaagtccaacatcaagcctcctccccctccagcttacacc
gaactcgatgcttcgaactttgacgaaattgcccttaacgagagcaaggatgtccttgtt
gccttcactgctccttggtgcggtcactgcaagaacatgaagcctgcctatgaaaaggtc
gctaaggtcttctcctctgagcccgacgtcgtcatcgccctgatggacgccgatgaggct
gagaataagcctgtcgctcagaggtatggtgtttcaagcttccctactatcaaattcttc
cccaagggttccaaggaccctgtcgcctatgactctggtaggactgccgaacagtttgtc
gattggatcaacgacaagtctggcactcaccgatctgtctccggtcttctttctgagact
gccggccgtgtcctcacgcttgacaacctcgcttccgagttcttttccgccaacgtccct
gagcgttctgagatcgtcaagaaggcccaggaggccgtcactaccctcgacaagaagagt
agggctaccgccgattactatatcaaggctatggagaggattaccgccaagggtgaagag
tggttggccaaggaacaagctcgacttgccaaccttctcgcttcctcttctctcgctcct
accaagctcgacgagctcaaggtcaagattaacattctttccgctttcgccgcccaaaag
gctggtgaggcgtacgactctgccgaagagattcttgagggcgcttgggactctgccaag
cagatccctatccaggcgaaggatggtctcgatcagttcgccgatgccgttgaggagaag
gcaaagaggattaggtctgatctctaa

DBGET integrated database retrieval system