KEGG   Cryptococcus gattii: CGB_B1110WHelp
Entry
CGB_B1110W        CDS       T02232                                 

Definition
palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cgi  Cryptococcus gattii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CGB_B1110W
  Lipid metabolism
   00062 Fatty acid elongation
    CGB_B1110W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CGB_B1110W
Lipid biosynthesis proteins [BR:cgi01004]
 Fatty acid synthase
  Component type
   CGB_B1110W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(248821..248945,249000..249141,249193..249264,249323..249740,249799..250031)
Genome map
AA seq 329 aa AA seqDB search
MRDFRFTPILALFFSNWAFAALSSDQLILSSSNARPRPLVIWHGLGDTALSTGIENFIDM
VQTIHPGIFVHSVQIPEDGSPDDERKAGFWGNAGDQGEEGCEQIKRIPELAEGFDGIGFS
QGGLFLRYYTQYCNGPPIHNLITFGTPHYGISALIPCPTPPTLSCLLAARAARAGIYRPW
AQNHLVQAAYFRDTERLDEFYEVNEFVRDLNGERPFAKHQDIEEINRRKGKRGEGKGLKG
LDNLVAIIFDDDRTVSPAQSSHFATYAPNNKTEIIPLHKQPLYKEDWIGLKGLEQKGGLR
LEHCPGEHMDLGGEKGCGEIMVSKWVGWV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagggactttcgcttcactcccatcttggccttgttcttctccaactgggcctttgca
gccctgtcttcggaccagctaattctctctagcagcaatgccagacccaggccccttgta
atctggcatggtctgggagatacagctctctcaacaggaattgaaaacttcatcgacatg
gttcaaaccattcacccgggtatctttgttcattctgtacagatccctgaagatggaagc
cctgatgacgaacgtaaggctggattttggggcaatgctggtgatcaaggtgaagaaggg
tgcgagcagatcaaacggataccagagcttgcagaaggttttgatgggatcggcttttca
caaggtggtctcttcttgagatactacacccagtactgtaatggccctccaatccataac
ctcatcactttcggaacgccccactacggcatctccgctctcatcccttgccccactcct
cccaccttgtcgtgcttactagcagctcgggcggctcgcgctggtatatatagaccatgg
gcccaaaaccacttggtccaggctgcttactttagggatacagagcggttggacgagttt
tatgaagtcaatgaatttgtaagggatctcaacggggaacgaccattcgcaaaacaccag
gacatcgaagaaatcaaccgaagaaaaggcaagagaggagaaggaaaaggtctcaagggg
ttggataaccttgtagctattattttcgatgacgataggacggtttccccagcccagtct
tcccattttgcgacctatgcgcccaataataagaccgaaattatccctcttcataaacag
cctctctacaaggaagactggatcgggcttaaaggtctagagcaaaagggtggtttgaga
ctagagcactgtccaggagaacatatggatcttggtggagaaaagggatgcggtgaaata
atggttagtaaatgggttggttgggtctga

DBGET integrated database retrieval system