KEGG   Cryptococcus gattii: CGB_B1720CHelp
Entry
CGB_B1720C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CGB_B1720C
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     CGB_B1720C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(join(411562..411833,412133..412466,412525..412751,412806..412948,413002..413284,413334..413478,413532..413704,413753..413862,413920..414019,414079..414175,414231..414315,414377..414467,414522..414777,414835..414972))
Genome map
AA seq 817 aa AA seqDB search
MSSDISPIILSSRVFRGASSDPTYRGVSWSNEGQCMVVTPRAITILTPHIASSLPPPRNP
LTSQQSMKISEAQKISNIKSGTQSTESGYNNDTQQPKARRLKGGGIQWWSTTIDVEINEE
REWLYGWGDASSNYLAMVETDGKGATVRQAAWSPSGLSNLGSCLLVVLTTSLQVSVYGPI
ENPLTERWTEIADLTMLTKDLLPPKEIRNGLTPRGVLEMRASSISWSASLPLSSMLGIDG
SILAVSDRNGKLALWTYGRQKRFQRLASISIGSPANWIADISWSDWTVKGDTCEALLALI
FTDGSVQLLKIQQHAKQKPDGPSQWNCTTGEPISVDNSDHRPVTAVKWVKDVLVWTKAGS
VHMFAGDECQSVSWKGTRNLRLERVGDWANANGLSACVGIHLINSSTLILTLASLTTHFV
HSFDKNPTLAPTVDNLRLAWPLRQMSLEPLSTSQPYLVERWRDLTNNHAGWTLQTSGWAT
IGEYGNNHTWITEPISLHTLHVSADADRHSYFFMANFDNVIAPETPVFSALKMIVEKPPN
PLRVSSKYVLLPFLLHLSSSPQENSAANLLQFLSSAIDGTADLESSLALKGWLVGVWESS
ALNSLRICLVLTIWCISAFPAFADEFQALRAKISTRVRSFLITLTLSWLVTTKITSRPIG
SFDRRFLYRLIKSAEGSSAPTTAPIISGAAEINQSHARHLVAELGIDGDAGYSGEPGKDK
EKSADGSPFTAETCSVSGLPITEVHCRRCTTCSACSLIPEHSFALQAVVGRDGKPEAPRN
VQIGIGRTDWIVSTLLEGAVGCVICGSRWILSAGCAL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgacatatccccaattatactcagctctcgggttttcaggggagccagttca
gacccaacttatcggggagtctcttggagtaatgagggccaatgtatggtagtgaccccc
cgggctataactatattaactccacatattgcatcttccctgccaccacctcgtaatccg
ctaaccagtcagcaatctatgaagatatcggaagcccagaaaatctccaatatcaagtcg
gggactcaatcaacagaaagcggatacaataatgacactcaacaacccaaagctagaagg
ttgaaaggtggcggaatacaatggtggtcaacaaccatagacgttgagataaatgaggag
agagaatggctgtatggatggggagatgcatcgagcaactacttggcaatggtggaaacc
gacggtaaaggggcaactgtacggcaggcagcttggtcgccttctggcttgagtaatcta
ggcagctgccttttagtggttctcactacttctttacaggtgtctgtctacggtcctata
gaaaaccctctcaccgaacgttggacagaaatagcggatctaacaatgttgactaaggat
ctactccctcccaaagaaatccgtaatggattaacccctcggggggtgcttgaaatgaga
gcttccagtatctcatggtctgcgagcctcccgctctcatcgatgttaggtatagatggc
agtatacttgctgtttccgatagaaatgggaaacttgccttgtggacctatgggcgtcag
aagagatttcagcggttagcttccatatctattggatcgccagcaaactggattgccgat
atttcgtggtctgactggactgtcaagggcgatacatgcgaagcccttcttgcgctcatc
ttcacagatggctctgtgcaattgctgaagattcaacagcacgcgaaacagaaacctgac
ggtccatctcagtggaattgtactactggagagcccattagtgttgacaacagcgaccat
aggccagtaacggcggtaaaatgggtgaaggatgtactcgtctggacgaaggcaggttct
gtgcacatgtttgctggtgatgaatgtcaaagcgtttcttggaaaggcacgcgaaatctg
agactagaaagagtgggtgattgggcaaacgccaacggcttgagcgcctgcgttgggatt
cacctcatcaattcctccactctcatcctcactcttgcctcactgaccactcacttcgtg
cactcattcgataagaatccaacgcttgccccgacagtggataatctgcgtttagcatgg
cccctgcgacagatgtcccttgagcctctgtccaccagtcagccatacttggttgagcga
tggcgagacttgaccaacaaccatgctggatggacattacagacatcggggtgggctacc
attggcgaatatggcaacaatcatacgtggataacagaaccaatcagtctccatacttta
catgtgtcggcagatgctgatcggcacagttactttttcatggcgaactttgataatgtg
atcgcacccgaaactccagtgttctcagccttgaaaatgatagtagagaaaccgcccaat
cccctgcgtgtctcttcaaaatatgttcttttgccgtttttgcttcatttatctagctcc
ccccaagagaactcggcggccaacctgttgcaattcctttcctctgctatagacggaacg
gccgatttggaatccagcttggcgcttaaaggctggcttgtcggcgtctgggaaagctcg
gcgctcaattccctccgcatttgtcttgtgctcacaatatggtgtatatcggctttccct
gcgtttgcagatgaattccaagcacttagagcgaagatatcgacgcgcgtccgttccttt
cttatcaccctgacactgtcatggcttgtcacaacgaaaattacgtcgagaccaatcgga
tctttcgaccgacgcttcctgtatcgccttatcaagagcgccgaggggagctcggccccg
accacagcgcctatcatttctggtgcggccgaaatcaaccaatctcacgccaggcatttg
gttgcagagctcggtatagacggggatgctggttattcgggggaaccgggcaaagataag
gaaaaatcggccgatggatcaccctttaccgcagaaacatgctctgtgtctggcctccca
ataaccgaagtccattgccgcagatgtacaacgtgctctgcgtgttctttgattccagag
cacagcttcgctctccaagcggtcgtcggtcgcgatggcaagccagaagcaccccgaaat
gtacaaataggtatcggtcgcactgactggattgtatcaacgctattggaaggagccgtc
gggtgcgtgatttgtggatctaggtggattttaagcgccgggtgtgcgctgtaa

DBGET integrated database retrieval system