KEGG   Cryptococcus gattii: CGB_B2080WHelp
Entry
CGB_B2080W        CDS       T02232                                 

Definition
carboxyl-terminal proteinase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CGB_B2080W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CGB_B2080W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(457929..457976,458124..458333,458383..458509,458577..458724,458788..458863,458927..459022)
Genome map
AA seq 234 aa AA seqDB search
MSETPSKWVPLEASPDWSEPLGLPQSLAFQDLFSLDPSFLSFVPTPHRAVLLLFPSKGKL
KEERSKEDQDDGNQFKGEGIWWIKQTIPNACGSIGLLHSLLNLPERGPDALNPDSKLAQF
KAESLPLSGLERAKLLDETTFFTAAHTNAAQTGQSVVPTDLDVDEHFIAFVEGVDEKGEK
RIVELDGGRNGPLDRGASNSFLEDVAKVVREKYFDRAEGDVNFNMIVLAGKSDD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaccgtccaaatgggtccctctggaggcttctcctgattggtccgagccc
cttggtcttcctcagtccctcgcgttccaagacctcttctctcttgacccttcttttctg
tccttcgtcccaacccctcaccgagcagtcttacttctctttccttcaaaagggaaacta
aaggaagagagaagtaaggaagatcaagacgatggcaatcagtttaagggtgaaggaatc
tggtggatcaagcaaactattcctaatgcctgcggctctattggcctccttcactctcta
ttaaacttacctgagcgaggtccagatgccttgaaccccgattcaaagcttgctcagttc
aaggcggagtctttgccattatcaggtctcgaaagggcgaagctcttggacgaaaccaca
tttttcactgcggctcacacaaatgctgctcaaacggggcagtctgtcgttcccaccgac
cttgatgttgacgagcacttcattgcttttgtagaaggtgtggacgagaagggggagaaa
cgtattgtagagcttgatgggggcagaaatgggccgcttgacaggggagcgtcaaacagc
ttcctcgaggatgttgccaaggtagttcgagagaaatacttcgacagggcagagggagat
gttaacttcaacatgatcgtactggcgggtaaatccgacgactga

DBGET integrated database retrieval system