KEGG   Cryptococcus gattii: CGB_B2160WHelp
Entry
CGB_B2160W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CGB_B2160W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_B2160W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(475941..476433,476500..476576,476638..477180,477231..478262)
Genome map
AA seq 714 aa AA seqDB search
MRKRRTTPRSNASRNSSISKQLAATLPDKQTESARKIQAISVEEQEPPVEQLSDSSSILV
CNSGNHLPWQAPPKPSVSKAHSTFAASNSKVTTVLPHIVFNDLWIDILSFFAQVYLTLYE
MTLGIGKWWAGTEIEDSHKGKERKVKEIKARRRRRRVESSSNSSDSATGRFFPGMVNLSG
TLCYMNSVLQSVASIPSLIIHLENVIDLAVEVDIPTHVTDALLDVIRDLNTPNKSPPPAL
RPHDLLTALYPLPAIRRLLGTHEQQDAHELFLVLAEAVSDEVVKVAAEVAKVRGIGEIIS
LQGYLSGKDDESGQHIKAGDVEGAKKRQRIRGVAQPWEGLLARRRVCQRCGWSEAIRMDT
LGGIELPVPLHGNTTLDACIMEYLAPEILSDVTCEMCSLKLTLDHYTLEVERLLGTSSKG
TPTEENGSGDGNQVSASRKKRAREVRRAEARLREMVNSNTVSDFGEPNLTPLPSSGLTAQ
IPVKWLTVKTASTRQCAIVRPPPSLQLHFIRSEFTMYGTVQKKTANVSFPLLLDLTRFVS
DGVWEERSGIKYMLASVSTEKTIPPRTGQKVIYQLESAILHYGFTHSSGHFVSIRRKPSP
PLTAEEKSFRPLKVAKNCPDGCKCEDCVYFGQVRDLEKTKVPGRGWLRISDADVEEVGEE
ALHEARGAVVMLFYERVMEYSAKTVAVSDERLKGKGGGQGVGEVVEDNIGHPLI
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgacgcacaactcccagatcaaacgcatcaagaaactccagcatcagcaag
cagcttgccgctacactgcctgacaagcaaactgagtccgcaaggaagatacaagccatc
agcgtcgaggaacaagaaccaccagtggagcaattaagcgacagcagctccattcttgtc
tgcaacagcggaaaccatttaccttggcaagcaccacctaaaccctctgtctcaaaggca
cattcgacatttgcagcttcaaatagcaaggtcaccactgtccttccgcatatcgtgttc
aatgatctctggatagatatcctatcattttttgctcaagtttatctcacattatacgaa
atgactcttggaattggaaagtggtgggctggcactgagatagaagatagccataagggc
aaagagagaaaggtaaaggagatcaaggccaggaggcgtagaagaagggttgagtcgtcg
agcaatagttctgattcggcgactggccgattcttccccggcatggtaaatttaagtggg
acgttgtgttatatgaactctgtccttcaatctgttgcttccataccctcactcatcatt
cacctcgaaaatgttattgatttggcggtagaagtagacataccgacgcatgtcacagat
gctcttctcgacgttattcgggacctcaacactcccaataaaagtccccctcctgctctt
cgaccacacgaccttcttactgccctatatcctcttcctgctattcgacgactattgggt
actcatgagcagcaagacgcccatgaactatttctggtgcttgctgaggcggtctcagac
gaagttgttaaggttgctgcagaggtcgccaaagtgcgaggcataggggagattatctca
ttacagggatacttgtccggcaaagatgatgaaagtggccaacatatcaaagcgggtgac
gtggagggagccaaaaaaaggcaaagaataagaggtgtggctcaaccatgggagggtttg
ttggcgagaagaagagtgtgtcaacgttgtggttggagtgaggctattaggatggacact
ctaggagggattgaattgcccgtaccgttgcatggcaataccacactcgacgcttgtata
atggaatatctcgcgcccgaaatactttcagatgtcacatgcgaaatgtgctctctcaag
ctcacactggatcattacacactcgaagttgaacgattgttgggcacctcctctaaaggg
actcctacggaggagaatgggtccggtgatggcaatcaagtcagtgctagtcggaaaaaa
agagctcgcgaagttcgtcgcgcagaagccagattacgagaaatggtcaattccaacaca
gttagcgattttggcgaacctaatctaacgcccttaccatcgtctggcttgactgcacaa
ataccggtcaaatggcttacggtcaaaacagcatccactcgacaatgtgctatagttcgt
ccccccccatctctccaactacatttcatccgctcggaattcaccatgtatggaacggtg
caaaaaaaaaccgcgaatgtctcatttccattgttattagatctcacaagatttgtctcg
gacggtgtgtgggaagagagaagcgggataaaatatatgctcgcatcagtctcaaccgaa
aaaacgatcccaccgagaacaggacaaaaggtaatatatcaactcgaatctgcgattctt
cactacgggtttactcattcttctggtcatttcgtcagtattcggcggaaaccctccccg
cctttgaccgcagaggaaaagtcattccgacccttgaaagttgcaaaaaattgtcctgat
gggtgtaaatgcgaggactgtgtttactttgggcaggtgagggatttggaaaagaccaaa
gtaccagggagaggatggctgcggattagcgatgcagatgtagaagaggtcggcgaagag
gcgcttcatgaagctagaggggccgtcgtcatgcttttctatgagcgtgtcatggaatac
tcagcaaaaacagtagccgtgtcagatgagcgacttaaggggaaaggtggtggacaaggc
gttggagaggttgttgaagataatattggacatcctttaatataa

DBGET integrated database retrieval system