KEGG   Cryptococcus gattii: CGB_B2400WHelp
Entry
CGB_B2400W        CDS       T02232                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CGB_B2400W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_B2400W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(542935..544094,544145..544287,544380..544440,544632..544873,544927..545227,545288..545523,545776..546591,546645..546753,546805..547069,547125..547659,547715..547911)
Genome map
AA seq 1354 aa AA seqDB search
MPVPAKSPSASIPHQSSSVSEHVDSPVIVDEPETGLPEAPYRPPEAVIDPPEDDPPPYTP
GIVAEHIGEDDNMEVDSKFTAKEFNAWQSNLELYDQMEIDQLTSQSSMPQLGPGVLPRRW
LAIAHEHELVRPYIEALPPPSKKFHSQTHAQAASGQVSSMSPPPQGPIPVFASNNPFAHE
SPRIATLEDVIQALPGDGSDPEHWYFCSTCWGWLKIKAGHGMPPGLQRMEEWEAFVIEQK
VYPDIESFEKAREQRRDEWARLIGIQNSRLVAPQEHHHFHQFNTLLLSSKLARIDKVEVE
EHMNVFPHITVGLDPEESWESFNLPHSPSRLFLSDSSDVWISVDEGLVPGQLPVGLVNAF
TAEKMSNPNPGLDGVQSVNEAWNLIATLLINPLFKGQRGWVNLNNAKFQSKIGAGLASSH
ILYHIGFACQEEPDVHDEGLDRGDALHIGIPKTKHVTAAAPFPDTIREACHILGATKYDT
AETLETAYDLQIMFDERNTPRYLGALEKISEAPVVGKSSLELKVAMERSLDKYTDDEVLK
AYSLIGYTRQHAEDISIPPQGAPDEYILSMHKSAIQASTSSQQRQDLNKALVLIGRERRS
EQLKSMGENGQTLVSVQEAYEALSAPRDAVDDGLIMQYEMAVNEYPGKADHYRMCLSVIA
DAPGEERPGLKQFLQTGSRGKLHATYSISHVSKVTTQNPMYPLEKIFLQDCKTLVVRQLR
LLFLQLYKTELPAVRPDEELAYLAITRPEIDRMVEQTQEPSTELSTAIDSAQITSNVLDS
IPSVPNLTTLPSPSSTIFASPPESPRQDLTSTPTPLGQNEITEEMVLDADKENIQSPESS
STQSRDASSTSTILGKRGNQDRERDYSRSPGEARIKCKQAEGSGNNGTREKFESKSALKV
ELGTGSRMDTAQADQVESPSLVTATEIAHLELTTPAGSPSQICKEEAEVLALTQPEDKYG
PPSTPPLLPARPQARKQETLSSGLRFGLQQDAAEVLINVLSQLELALEQPGEDGKEASNL
IKNLFSCKYRQQTVYESSPFSSDGQPTYDAQTPVESVFTHPIIGVEEEGKDLYDCLAELY
LGGSAIEYEGKKGYMMDLMDEFPPMLYIQMRRSQYDPLTGRDRKTNTHISFPQTLCMSRF
LTSAPSEKREESVALTREITRVRTRLHSLINHTPLSIPSTYKHASSALKQLASSGLDISE
LDGVLSPELCDALDREGDEVIKEIEELQQELPKLKERMDEIWKDVHREEEEEDEHVKSYD
YELVSVYMHRGKTSGSGHYWTYQAHLPGHSEEFYNYNDEKVTVVPASEVLQDRTGSDANP
ALLCYARKGWNLIDSLHREILEHGSPEVEELVLV
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttcccgccaagtctcccagtgccagcatcccgcaccagagttcttccgtctct
gagcatgttgattctccagttattgtagacgagccggaaaccggtcttcctgaggcaccg
tataggcctccagaggccgtcatcgatccaccagaagatgatccacccccttataccccc
ggcatcgttgctgagcatattggagaggacgataatatggaagtagactcgaagttcact
gccaaagaattcaatgcgtggcaatccaacctcgaactgtatgaccagatggaaatcgat
cagctaactagtcaaagttcgatgcctcagttgggaccaggtgtacttccacggagatgg
ctagcaatcgcccatgagcacgaactcgtcaggccatatatagaagcacttccaccccca
tccaagaagttccactctcaaacccacgctcaggcggccagcggtcaggtgtcatcgatg
tcaccaccaccacaagggccaattcccgttttcgcctcgaacaatccctttgcccacgag
tcgccccgtattgcaactctcgaagatgtcatccaagcacttccgggggatggaagcgat
ccggaacactggtatttctgtagcacctgttggggatggttgaagattaaggcggggcat
ggcatgcccccagggcttcagcgcatggaagaatgggaggcttttgtcatcgaacagaaa
gtttatcctgatatcgagagttttgagaaggcacgtgaacagaggagagacgagtgggca
aggctcataggtattcaaaactcgaggttggtcgctccccaggagcaccatcactttcac
caattcaataccttgcttctctccagcaagttggcacgcatcgacaaggttgaagttgaa
gaacacatgaacgttttccctcacatcacggtcgggctcgatcccgaagaatcatgggaa
tcattcaacctcccccattcaccgtccaggttgtttctcagtgactcttccgatgtttgg
atatcagtagatgagggattggtgccaggacaacttcccgtgggcttggtgaacgccttt
acagcggaaaaaatgagcaatcccaaccctggtctagatggtgtgcaaagcgtaaatgag
gcttggaatcttattgccacgcttttgataaatcctctattcaagggccaaagaggttgg
gtaaatctcaataatgccaaattccagtcaaagatcggggctgggcttgcctcctctcat
attctgtatcatatcggcttcgcctgtcaagaggagcctgacgtacatgatgagggtttg
gatcgaggtgacgctctacatattggcattcctaaaacgaaacacgtgacagctgctgct
ccctttccagacaccattcgggaagcttgtcatattctgggtgccaccaaatatgacact
gctgaaactcttgaaaccgcatacgatcttcaaatcatgtttgacgaacgcaatacacct
cggtaccttggtgcgctagagaaaatttcggaggcgcctgtggttggaaagagtagtctg
gagttgaaggtggcaatggaaaggagtttggacaagtatacagacgatgaagtgctaaag
gcatatagtctaattggatacactcgccagcacgccgaagatatttctatacctcctcaa
ggtgcgcctgacgagtatattctctccatgcacaaatcagccatccaagcctcgacttcc
tctcagcaacgtcaggacttaaataaagcgctagtcttaataggcagagagaggagaagc
gagcagctgaagagtatgggcgagaacggacagacccttgtcagcgtacaggaagcgtat
gaggctctaagtgccccacgggatgcagtcgatgacgggttgatcatgcaatatgagatg
gccgtcaacgaatatcccgggaaagcagaccattatagaatgtgtctctccgtcattgcg
gatgctcctggagaagaaagaccagggttgaagcaattcttgcaaaccggctcaagaggt
aagctgcatgccacgtactcgatcagtcacgtttctaaagttaccacccagaacccgatg
tacccgctagaaaagatattcctgcaggattgcaaaacattggttgttcgccaacttcga
cttctttttctccaactctataagacggaactgcccgctgtccgtccggacgaagaatta
gcttatctcgccattacaagaccggaaatagatagaatggtcgagcaaacacaggaaccg
tcgacggaactctctacagctatagactctgctcagatcacatcaaacgtattggacagc
attccatctgtaccgaacctcacaactcttccctcaccttcatcgactattttcgcctcg
ccacctgaatcaccccgacaggatttgacaagcactcccactcctttgggacagaacgaa
ataacagaggagatggtgttggacgcagataaagagaacattcaatccccggaatcgtca
agtactcaatctcgggacgcctctagcacgtctaccattctcgggaaaaggggtaatcaa
gatagagaaagagactattctcgctcccctggtgaagcacggataaaatgcaaacaggct
gaaggatcaggcaataacggtactagggagaaatttgaaagcaagagtgcactgaaagtt
gagctggggaccggctccagaatggacacggcgcaagctgatcaagttgaaagcccatca
ctcgttacggctacagaaatagcccatctggagctgacaacaccagcggggtctccaagt
cagatttgcaaggaggaggcggaagttttggctcttacgcagccagaggacaagtatgga
ccgcctagcactcctccactactcccagcaaggccacaggctcgtaagcaagaaacgctc
agctcgggtttacgatttggtttgcaacaggatgctgctgaggtacttattaatgtactt
tctcaattggaactggcgttggagcagcccggagaagacgggaaagaggcatctaatctc
atcaaaaatctgttttcttgtaaatatcgccagcagacggtgtacgagtcctcgcctttt
tcgtctgatggccaacctacctatgatgcacagacgccagtggaatctgtcttcactcat
ccgattatcggtgtcgaggaggaaggcaaggacctgtatgactgtctggcagaactgtat
ctgggtggctcagccatcgagtatgagggaaagaagggctatatgatggatctcatggac
gagttcccgcccatgctgtatatccagatgcggagatcgcaatacgatcctctcacaggc
cgagatcgcaaaaccaacactcatataagctttcctcagactctttgcatgtcacgcttc
ctgacctctgcaccctccgagaaacgcgaagaatccgtcgccctcacacgagaaataact
cgggtacgaacacgtcttcattcactcattaatcatactccgttatctatcccatcgacg
tacaagcatgcctcttctgccttgaagcagctcgcttcgtcaggcctggatatatcggaa
cttgatggcgttctatcaccagaactttgtgatgcacttgaccgtgaaggtgatgaggtt
atcaaggaaatcgaggaattacagcaagagctacccaaattgaaggagagaatggatgag
atctggaaggatgtgcaccgggaggaagaagaagaagacgaacatgtcaagtcctatgac
tatgaattagtgagcgtatacatgcatcgagggaagacgagtggctcggggcattattgg
acctatcaagcgcatttaccagggcatagcgaagaattttacaattacaatgacgaaaaa
gtcactgtcgtgccagccagcgaagttttacaagaccgaacaggcagtgatgctaatcca
gcgctactttgctatgcccgcaagggctggaatttgattgattctttgcatagagagata
ttggagcacggcagcccggaagtagaagagctggtgctagtttga

DBGET integrated database retrieval system