KEGG   Cryptococcus gattii: CGB_B3420CHelp
Entry
CGB_B3420C        CDS       T02232                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cgi  Cryptococcus gattii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cgi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cgi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cgi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cgi00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(join(765188..766103,766154..766346,766393..766518,766574..766655,766727..766840,766921..767040))
Genome map
AA seq 516 aa AA seqDB search
MSSLARIQLLPRMSRPVATSRLAVLNRHLSSSSQMAAPREELVLFESQQDTRIYKLNRSA
KLNSLNHEMIDSLSNKIKAWRELDSCKVIIGTGDSRAFCAGGDVKQLVLDLKEGKQTAVP
FFKSEFQLNWLLARLGKPYVAVIDGVTMGGGGGISLPAHIRIATPRTIFAMPETKIGYSP
DVGSNYYFAQLDGFIGAWLAVTGQEVYGRAAYELGIATHYVTENNISDIIYQITQHPSPT
PANISSLISSYTAPASTTSAVSSKSSPDGPTPIKGEIRKFLDKTFNKKSIQEIYAALDKS
QSDDKLSSEVKEWAAQQKLQMEARSPTGMAVALQNYRKARETRRLDRTLLNDISMATAYT
GTNRATDDFITGVSAVLIDRSKGPVAWAPKDINEESLSPQNINSRFFSASSPHVADKPEI
EFIPSSASKLDSGRDSTWGQFRKYGLPSEEAVRAAVDGYAPGSGAFALLEEELIEQFIDA
QGDVQGTRRDEVVKRVKGVVNTCCKKGKDGYLEWIA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccttagcccgtatacaactcctaccgcgtatgtctcgcccggtagccacctct
aggctcgcagtactcaacagacatctctcctcatcttcgcaaatggccgccccccgcgag
gaactcgtgcttttcgagtctcaacaagacaccaggatatacaagctcaatcgatctgcc
aagttgaattcccttaatcatgagatgattgattctctgtcaaataaaatcaaagcttgg
cgggaacttgattcttgcaaagtcatcatcggaacaggcgatagtcgggcattttgcgcc
ggtggggatgtaaagcaactcgtcctcgaccttaaggagggcaagcaaactgcggttcca
ttcttcaaaagtgaatttcagctcaattggttgctcgcaagactaggaaagccttatgtc
gctgtcattgacggtgttaccatgggtggtggtggcggtatttctctccctgcgcacatc
agaatagccactccacggaccatcttcgccatgcctgaaaccaagattggctactcccct
gacgtcggttctaactactacttcgctcaactcgatgggttcatcggcgcttggctcgcg
gtgaccggtcaggaagtgtacggtcgtgcagcctatgaacttggtattgcgacacactat
gtgaccgaaaacaacatctcggatatcatctaccagatcactcagcacccttcccccact
cctgcgaacatttcctccttgatttcctcctacacagcgcccgcttctactaccagcgct
gtctcgtcgaaatcttcccctgacggacccactcccatcaagggcgagattcgcaagttc
cttgacaagactttcaacaagaagagtattcaagaaatttatgcggccttagacaagtca
cagtccgacgacaaactctcctccgaggttaaggagtgggctgcccagcaaaagcttcaa
atggaagctcgctcaccgactggtatggctgttgcccttcaaaactatcgcaaggctcgt
gagacccgtcgacttgaccgaacattattgaacgacatatcgatggccactgcttacacc
ggaaccaatcgcgcgacagatgatttcatcactggtgtttcggcggtgcttattgatcgc
tccaaaggtccagttgcgtgggcacctaaggatatcaacgaagagtctttgtccccgcaa
aatatcaactcaagattcttttctgcatcatctcctcatgtcgcagacaaacccgagatt
gagtttataccctcttccgcgagcaagctcgactctggtagggactctacctggggtcag
ttccgaaagtatggtctgccatctgaagaggctgtacgggctgcagttgatggatatgcc
cctggctccggcgcgtttgcgcttctagaggaagagttgatcgagcaatttatagatgct
cagggtgatgtacaagggactaggagggatgaggtggtaaagagagtcaaaggcgttgtg
aacacttgctgcaagaagggaaaggatggatatctcgaatggattgcctaa

DBGET integrated database retrieval system