KEGG   Cryptococcus gattii: CGB_B3520WHelp
Entry
CGB_B3520W        CDS       T02232                                 

Definition
(RefSeq) ubiquitin-protein ligase
  KO
K03350  anaphase-promoting complex subunit 3
Organism
cgi  Cryptococcus gattii
Pathway
cgi04111  Cell cycle - yeast
cgi04113  Meiosis - yeast
cgi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CGB_B3520W
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CGB_B3520W
   04113 Meiosis - yeast
    CGB_B3520W
Protein phosphatases and associated proteins [BR:cgi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CGB_B3520W
Ubiquitin system [BR:cgi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     CGB_B3520W
Chromosome and associated proteins [BR:cgi03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    CGB_B3520W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_19 TPR_16 TPR_11 TPR_14 ANAPC3 TPR_17 TPR_12 TPR_15 TPR_9 BTAD DUF1387 PknG_TPR DUF3519 TPR_21
Motif
Other DBs
NCBI-GeneID: 10187352
NCBI-ProteinID: XP_003192112
UniProt: E6R0J4
Position
B:join(783843..784131,784254..784461,784543..784743,784798..785440,785501..785862,785937..786054,786112..786450)
Genome map
AA seq 719 aa AA seqDB search
MNTHVAARLQQLASSYPPHTALFYARIWHTLAPATDNNHDSLHALALAFLQAAEPYSAIH
LVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCYLTLPTPSSNPATAYLLLANLSHK
GKSPETAIENYRKALDEDPWMWEAFTSLCDVGTLDFTVVSLFQPTQHASRSSRPPLSPNV
HRQKSPIEPAPGVLRLHQAQAGVGNSGGLFTPDVEGMGGKTGLGMMGNTSSWDSSSIMGD
ATFALPEQQTKRPFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRP
GPVETPQSQMSSGLPLARELRPNGAKYEDSDAPRRSSRLKTTTSKSSSKNPRDPRVTRSR
SVTSSNSNNEAPSPPSLTSQDAILQKEADEYLKDIVKKCARVYKSLSQYQCQQAIKEVDV
LPGELKTSPWAMEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQFSTLLWHLTDLP
ALSYLSQSLISISRTSPQAWIAVGNCFSLQKDHDEAMRCFRRATQLDEGCAYAWTLCGYE
AVEMEEYERAMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPTNPV
LLCCVGMALEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISALEPLT
HSAPDEANVFFLLGKCLFKKERRQEATVAFTNARELEPKLESAINAVLVANGEEGEESE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccacgtcgcagcccgtctccaacagctcgcatcctcatacccgccacacaca
gccctcttctacgcccgcatatggcataccctggctccagccacagacaacaaccatgac
tccctccacgctcttgcactcgctttcctccaggcagcggagccatattcagccatacac
ctcgtcagagaccacactggcctcgacaacctcgacttggaccttgaaatcaggttcgaa
aggacagacaaggtgtgtggtgggtgtgccatgatcgttgcccgctgctatttaacattg
cctacaccctcgtcaaatcctgcaacggcatatctcctgctggccaacctctcgcacaag
ggcaaatctccagaaacagccatcgaaaattataggaaagcacttgatgaagatccttgg
atgtgggaagcctttactagcctctgtgacgttggtacgctggattttactgttgtgtct
ctttttcagccaacccagcacgcctcgcgatcgtcaagaccccctttatcgccaaacgtt
catcgccaaaagtctcctatagagccagcacctggcgtactgaggctccaccaagcgcaa
gctggtgttggcaatagtggcggattgtttacacctgatgtcgagggaatgggagggaaa
acgggtcttggtatgatgggcaacacttcgtcttgggactcttcatccataatgggcgac
gccacttttgcgctccctgaacaacagaccaagagaccatttccgtcgttcatgtcaact
gctaccagttttcttccatcatctcttcggggtggtacatccaccccagcagggagtgat
tctcctcccaaactgcccactatgaaacgtccccgaggcaaagatcctgtcaaaaggccg
gggccggtcgaaacgccccagtcacagatgagcagcggactgccccttgccagagaattg
aggccaaacggtgcaaaatacgaagactcggatgctcctcggcgtagctcgcggctcaaa
acaacaacctctaaatcttcgtctaaaaacccccgcgatccgcgcgtcacgcgctctcga
tcagtcacttcctccaactccaataacgaggctccttctcctccctcgttgacatcgcaa
gatgcgattctacaaaaggaagcggatgagtatctcaaggatatagtgaaaaaatgcgca
agggtttacaaaagtctaagtcaatatcaatgccagcaagccatcaaggaggtggatgtt
ttgcctggagaattgaagacatcaccatgggcaatggaaattttagggagggcgttttat
gaaattgccaactatgccatggcacgacgagcatttacatttcttcaacagcaagaaccg
taccgcatccaatccatggagcagttctccactcttctttggcatctcaccgatctacct
gcgctttcatacctttctcaaagcttgatctcaatcagtcgtacctctcctcaagcttgg
atcgccgtggggaattgctttagcttgcaaaaagaccatgatgaagctatgagatgtttc
aggagagcgacacaacttgacgaaggttgcgcatatgcatggacattgtgtggatatgaa
gcagtagagatggaagagtatgagagggctatggcgttctatagaaccgccatcagaaca
gatgcgcggcattataacgcttggtatgggatggggttagtttatctcaaaacagatagg
ccgcgatatgcggagcatcactttagaagggccgtcgaaattaacccgaccaatcctgtc
ctcttatgttgcgttggcatggcgttggaaaagtctgacgacgttgtgcaagctcttcat
ttttacgagcgtgcctccaaatacgcacccacctccgcgatggtgcagttcaaacgcatt
cgggcccttgtcgctcttcaacggtacgacgaggccatttcagcgctcgaacccctcaca
catagcgcaccggacgaagcaaatgtcttcttcttgctgggaaaatgtttattcaagaag
gagagaaggcaagaagccacagtggcttttacgaatgctcgtgaactggaacccaagttg
gaaagcgccatcaatgctgttttggttgcaaacggagaagaaggagaggagtcggaataa

DBGET integrated database retrieval system