KEGG   Cryptococcus gattii: CGB_B3710WHelp
Entry
CGB_B3710W        CDS       T02232                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cgi  Cryptococcus gattii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CGB_B3710W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CGB_B3710W
Transfer RNA biogenesis [BR:cgi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CGB_B3710W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(832533..832612,832664..832927,832998..833061,833119..833125,833179..833372,833428..833895)
Genome map
AA seq 358 aa AA seqDB search
MASQLPFTRLVKETQIGILSVLRACYLTKNVQDTLVTKDTLLKSDKSPVTVADLSAQSLI
SLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNAGFKKEEGWGKDKTYSEEEILNAI
DAGSAEGGSKGRFWTIDPVDGTSGFIRHQQYAVCLALIVDGVVELGVIGCPNLGPEPAKI
GEEIIPNGKGVLMVAVRGEGSWSRPLDSATYTKLNLPPTPPASNPLTFLESVESGHSAHS
IQARIGSLLGVQRPSLRMDSQAKYTCLSRGEGGVYLRIPTKYVGGKIYEERIWDHAPGAL
LIHESGGICTDMWGKELNFGIGRTLKGNDGIVAAGKDIHPKAVEAVKKAIEEAQAEKK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcagctccccttcactcgtcttgttaaagaaacacagatcggcattctttct
gttctcagagcatgctacctcacaaagaacgtccaagacaccctcgtcacaaaggatact
cttctcaaatcagacaagtctccagtgacagtcgcagacctttctgctcagtcgctcatc
tctctccaccttctcgcccactttcaagaccctatcattggcgaggaagacacgagcgag
ttgagagtgaatgagccgttgagacagagggtcgttggacttgtcaatgcaggatttaaa
aaggaggagggatggggcaaagataaaacttattcagaggaggaaatcctgaatgctatc
gacgcgggctctgctgaaggtggtagcaaaggtagattttggactattgatccagtcgac
ggaacttctggcttcattcgtcaccagcaatacgctgtatgccttgcactcattgttgat
ggcgttgtcgagctcggagttatcgggtgccccaaccttggccctgagccggccaaaatt
ggtgaggaaatcattcctaatggcaagggtgtcctcatggtagctgtgaggggtgaaggc
agctggtcgcgccctcttgattctgctacctacacaaagttgaaccttccccctacccct
cctgcctccaaccccctgactttcctcgagtccgtcgagtccggccactctgcccactct
atccaggctcgaatcggctcccttctcggtgttcaacgtccctccctccgtatggattct
caggccaagtacacctgtctctctcgaggtgaaggcggtgtctatcttcgtatccccaca
aaatatgttggaggtaagatctacgaagagcggatctgggatcatgctcctggagctttg
ttgatccacgaaagtggtggtatctgtacagacatgtggggcaaggaactcaactttggt
ataggaaggactctcaagggaaatgacggtatcgttgctgccggtaaagatattcatccc
aaggcagtcgaagcggtcaagaaggcaattgaagaggcacaggccgaaaagaagtga

DBGET integrated database retrieval system