KEGG   Cryptococcus gattii: CGB_B3750WHelp
Entry
CGB_B3750W        CDS       T02232                                 

Definition
(RefSeq) transcriptional activator Gcn5
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CGB_B3750W
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CGB_B3750W
Chromosome [BR:cgi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CGB_B3750W
   HAT complexes
    PCAF complex
     CGB_B3750W
    STAGA complex
     CGB_B3750W
    TFTC complex
     CGB_B3750W
    SAGA complex
     CGB_B3750W
    SLIK complex
     CGB_B3750W
    ADA-HAT complex
     CGB_B3750W
    HAT-A2 complex
     CGB_B3750W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-GeneID: 10187339
NCBI-ProteinID: XP_003192122
UniProt: E6R0L7
Position
B:join(845342..846025,846074..846697,846750..847061,847109..847369,847422..847545,847607..847640,847706..847854,847915..848111)
Genome map
AA seq 794 aa AA seqDB search
MAPKSRRATNSEAKTTSTSAISPPEHSSPARSRGGSSSLSPIRSPKEDSDLDDNSELNPK
TNESGLKAEDEELTDVPDRDEDLEEIHVCPDNITFRYPSSVPDFTILSQHEKAFKVARFL
PCTAPSCACTGLEPPAGRTIKITKHGTSNEEDEDDEDEDDDVSMEDAENPSEFEDRKAEW
RTKEGWWRICGKCGHGWENGGHVWGDDVPPKERTRRGKVVGRIEEILEDENKLIEFPTPE
SQSISSLLKQLHEFVPPPAGKTTISGLPPPVDLSTPDDDTQGDHSDHEPPRKRQRRASES
TSSDIEEEHHRVQGKRKPGKGPAKGAKPRIPRTVVRGAHGFIPMATDPDGNQHVEGHLPI
SAGGAGADEDFEEEEEEEEELSTAKRPELDETERKRRTEIKVKEKEREEELVSRLAAGVN
PEDGEGAVEIWEGIELQKLPLRPAAIEQANREIMLPVVSSRNPTPVATILLVGLKNVFQR
QLPKMPREYITRLVLDKNHISMAIVKRGYRVVGGICYRPFEARGFAEIVFCAVDSSEQIK
GYGSHLMNSLKDHVRKAHPTINVFLTYADNYAVGYFKKQGFTKEISYPRERWVGYIKDYE
GGTIMQGRMLPKVKYMEVHQMLADQKAAIIAKIKTFTKSHIIHPGLQIFKERQPDEEIKL
TKEQVPGLAESGWNPDLDDIVRQPKRNPYHVLLQHVLNDLQNEPSAWPFVKPVDSSVVAD
YYDVIKDPMDLSTMEHKLENNHYESIEGFVADVKLMCANCRQYNGEKSTYTKQANLLEKA
LDRILKKRKSVLTD
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaatcacgtcgtgcaaccaattccgaagccaaaacgacgtcaacatctgct
atctctccacccgaacattcatcaccagcacgctcaaggggcgggtcgtcatccctctcc
ccgatcagatcacccaaagaagattcagatttagatgacaatagcgagctgaatccaaag
accaacgagtccggactgaaggccgaagacgaagaactgacagatgtgcctgatagagat
gaggacttggaagaaattcatgtctgcccggataatatcacatttcgttatccttcgtcg
gttccggattttaccatcctcagtcaacatgaaaaagctttcaaagtagcaaggttctta
ccgtgtaccgcccctagctgtgcctgcactggccttgaaccacctgccggcagaacaatc
aaaataaccaaacatggtactagtaatgaagaagatgaagacgatgaggacgaggatgac
gatgtatccatggaggacgctgaaaatccatcggaatttgaagacagaaaagctgaatgg
aggacgaaagaggggtggtggagaatatgcggaaagtgtggacatggttgggagaatggg
gggcatgtttggggcgatgacgtccctccgaaagaaagaacaaggagaggcaaggttgtt
ggaaggatagaggaaatactcgaggatgaaaacaagctcattgaattccccactcctgaa
tcccaatccatttcttccctgttgaaacagttacacgaattcgtacctccgcctgccggg
aaaacgaccatttctggtctccctcctcctgttgatctttctacccctgatgatgataca
caaggagatcatagtgaccacgaaccaccaagaaagcgccaacgccgagcaagcgaatct
acctcctctgatattgaagaagaacatcaccgcgttcaagggaaaaggaagccaggaaag
ggccccgcgaaaggtgctaaaccgagaataccccgtactgtcgtccgaggggcgcatgga
tttattcctatggcgacggaccctgacggcaatcagcatgttgaaggacatctccccatt
agtgctggcggtgcaggggctgacgaagactttgaagaggaggaggaagaagaggaggag
ctatcaacagctaaacggccagagctggatgagaccgagagaaagagaagaacagaaatc
aaagtcaaggaaaaagaaagggaagaagagctagttagcaggttggctgccggagtcaat
ccggaggacggcgaaggggcggtcgaaatttgggaagggattgagctgcaaaaacttccc
ctgcgaccggccgcaattgagcaagcaaatcgagaaatcatgctacctgtcgtgtcctcc
cgtaatcccactccggtcgcgactattctcctggttggccttaagaatgtcttccaacgt
cagcttccaaagatgcctagagaatacattacccgcctggtattggacaagaatcacatt
agtatggcgattgtcaaacgaggatacagagtagtaggtggaatttgctacaggcccttt
gaggctcgaggatttgcagagattgtgttttgtgccgtggacagctccgagcaaattaag
ggttacgggtcacatttgatgaattctctcaaagaccacgttcgaaaagcccacccaact
atcaacgttttcctgacttatgccgacaattatgctgtgggatatttcaagaagcaaggt
tttaccaaagaaattagctatccccgggagcgctgggtcggttacatcaaagactatgaa
ggtggaaccatcatgcaaggccgaatgctgccaaaagtcaagtatatggaagtccaccaa
atgttagcggaccaaaaggctgccataatcgccaaaatcaaaaccttcactaaatctcat
atcattcacccgggtttacaaattttcaaggagcgccaacctgatgaagaaatcaaactc
acaaaggagcaagttcctggattggctgaaagtggatggaatcccgatcttgatgatatc
gttcgccaacctaagcgaaacccataccatgtcctccttcaacatgttttgaatgacttg
caaaatgagccttctgcatggccatttgtaaagcccgtggactcaagtgtagtggcggac
tactatgatgtgatcaaggaccccatggacctttccaccatggaacacaaattagagaac
aaccattacgaatccattgaaggctttgttgccgacgtgaagctcatgtgcgcaaattgc
cgacagtacaatggcgaaaagagcacctacaccaaacaagcaaacttgttagaaaaagct
ctggatagaatcttgaaaaagcgaaaatcagtactgactgactga

DBGET integrated database retrieval system