KEGG   Cryptococcus gattii: CGB_B4100WHelp
Entry
CGB_B4100W        CDS       T02232                                 

Definition
steroid 5-alpha-reductase type I
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CGB_B4100W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(901194..901208,901282..901353,901411..901526,901587..901853,901967..902150)
Genome map
AA seq 217 aa AA seqDB search
MGHHGPITFLTTIINDSHPSLNGPSKILSGLFLAHYAHRAIISPLILSPKRSPLHITVVI
AATLFNLLNGYLLAVGLAFYPPKEIGWQFIFGVIGWAIGFFGNVYHDEILNDLRRPPTRR
IISSHLPEDDASEKERYKVPRGGLFKWISFPNYLCECSALLTARPRVWGFPYDAVHLIKA
LLALLAARPHLDICACGGDIDVAQSSERACLVQGKVR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgggccatcatggacctataacttttttgacgacaatcataaacgattctcatccttct
ttgaatggtccctcgaaaatactctcagggctattcctcgctcattatgcccatcgggct
attatatcacccctaatcctttcaccgaaaaggtcgcccctccatattactgtcgttatt
gcggccacacttttcaatctcctgaatggatatcttttggccgttggcttggctttttac
cctccgaaagagataggatggcaattcattttcggtgtcattggatgggcaataggattc
tttgggaatgtctaccatgacgaaatcctcaacgatcttcgtcgacctcctacgcggaga
ataatatcgagtcatcttccagaagatgacgcttccgaaaaggaaagatacaaagtgccg
cgaggtgggctatttaagtggatctcatttccgaattacttatgtgaatgctctgcccta
cttactgcgcgcccccgagtatggggattcccatacgatgctgtccatcttatcaaagct
ttactggccctcctggctgctcgcccccacttggacatttgtgcttgcggaggtgacatc
gatgttgcccagagcagtgagagggcatgcttggtacaaggaaaagttcggtaa

DBGET integrated database retrieval system