KEGG   Cryptococcus gattii: CGB_B4190WHelp
Entry
CGB_B4190W        CDS       T02232                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cgi  Cryptococcus gattii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CGB_B4190W
Enzymes [BR:cgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CGB_B4190W
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGB_B4190W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(917368..917411,917464..917713,917780..918168,918233..918320,918373..918589,918646..918704)
Genome map
AA seq 348 aa AA seqDB search
MSHTAHFQVPPLQISSVLHGGIHHPTLRTWQANGRNLTKSMLIYPIFISDDPDAEQEVVT
LPGQKRWGLNKLEGFLKPLVEKGLKSVILFGVPTTMEKDPHGSAADDESTPVIQALKLLT
NIFPQLMLCVDVCLCEYTSHGHCGILSSLPNPAHSNAPTLDAEASAQRIAEVAVAYAKAG
AHCVAPSDMMDGRIRAIKYGLMQVGLANRCALMSYSAKFASGLYGPFRDAAGSAPSFGNR
KCYQLPPNARSLARRAIQRDAGEGADILMVKPALPYLDIISDCAQYAPDHPTACYQVSGE
YAMVVAGAEKGIYDLKEMAFETTESMVRAGASIILTYFTPQFLDWLDE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacacagcccacttccaggttccccctctccagatatcctccgtactccacggc
ggtatccatcaccctactctcagaacatggcaggctaatggacggaacctcacaaagtct
atgcttatctaccccatcttcatctcagacgaccccgacgctgaacaagaagttgtaact
ttgccgggacagaaacgatggggtctcaacaagcttgaggggttcctgaagcccttagtg
gaaaaaggattgaagagtgtaattctgttcggtgtgcctactactatggaaaaggatcct
catggcagcgctgccgatgacgaatcgactcctgtcattcaagcactgaaacttcttacc
aatatcttcccccaactcatgctttgcgtagacgtttgcctatgtgaatatacatctcac
gggcactgtggcattctctcgtctcttccgaacccagctcattccaatgcccccaccctt
gacgcggaagcttcagctcagcgaattgctgaagttgctgtcgcttatgccaaagctggt
gctcactgtgtggcgcctagtgacatgatggacggaagaatacgagcgatcaaatatgga
ttgatgcaggttggattggccaacaggtgtgctttgatgagttactcggccaagtttgct
agcgggttatacggacctttccgagacgctgccggaagtgcaccttcatttggcaacaga
aaatgctatcagcttcctcccaatgctcgtagccttgctagaagagctattcaacgagat
gctggcgagggcgctgatatcctcatggtcaagcctgctctcccttacctcgacatcatt
tcagattgcgcgcaatatgcccctgaccacccaaccgcctgctaccaagtctcaggtgag
tatgccatggtcgtcgctggtgcagagaagggcatctatgatctgaaggagatggcgttc
gaaactacggaaagcatggttcgcgcgggagccagtataatcctgacatatttcactcct
caattccttgattggcttgatgaatga

DBGET integrated database retrieval system