KEGG   Cryptococcus gattii: CGB_B5461WHelp
Entry
CGB_B5461W        CDS       T02232                                 

Definition
protein phosphatase type 1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cgi  Cryptococcus gattii
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CGB_B5461W
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CGB_B5461W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CGB_B5461W
Protein phosphatases and associated proteins [BR:cgi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CGB_B5461W
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CGB_B5461W
Spliceosome [BR:cgi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CGB_B5461W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(join(1217511..1217557,1217921..1217978,1218028..1218162,1218214..1218365,1218416..1218592,1218643..1218873,1218930..1219061,1219120..1219174))
Genome map
AA seq 328 aa AA seqDB search
MGEQPEIDLDSVIDRLLEVRGNRPGKAVQLAEYEIKYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
QSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLLCSFQILKPAE
KKPKYGGYGGSARPVTPPRKGKPNKRKA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacagcctgaaattgatcttgactcagtcatcgaccgactgttagaagtgcga
gggaacaggccaggcaaggcagtgcagttggcagaatacgaaatcaaatacctttgcacc
aaagcccgtgaaattttcatcagtcagccgatcctccttgaactcgaagcgcccatcaaa
atctgtggtgacattcatggacaatattacgacttgttgcgtctatttgagtacggtggt
ttcccccccgaagccaattacctcttccttggtgattatgtcgatcgaggcaagcagtct
cttgagactatctgcctgctgttggcgtataaaatcaagtaccctgaaaactttttcatc
ctgagaggaaatcatgagtgcgctagtattaatagaatctatggattctatgatgagtgc
aaacgtcgctacaacattaaactctggaagacttttaccgactgcttcaactgtctcccc
attgcggcgatcatcgacgagaagatcttcacaatgcacggaggtttgagtcctgacttg
caaagtatggagcagattaggagagttatgcgaccaacagatgttccggacaccggcctg
ctttgtgatttgctttggtctgatccggacaaggacatcactggatggagcgagaacgat
cgaggagtctcgttcacttttggtccagacgttgtttctcggttcttgcaaaagcacgat
atggacttgatttgtcgagcgcatcaggttgttgaagatggttacgaattcttcgccaag
cgacagcttgtcactctgttctctgcccctaattattgtggcgaatttgataatgctggt
gcgatgatgagcgtagacgacactttactttgctccttccaaattctgaaacctgccgaa
aagaagccgaagtatggtggatacggcggcagcgcgcggccggttacccctccacgtaaa
ggcaagccaaacaaaagaaaggcgtga

DBGET integrated database retrieval system