KEGG   Cryptococcus gattii: CGB_B6540CHelp
Entry
CGB_B6540C        CDS       T02232                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cgi  Cryptococcus gattii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGB_B6540C
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGB_B6540C
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CGB_B6540C
Enzymes [BR:cgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CGB_B6540C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(join(1454944..1455208,1455259..1455368,1455422..1456217,1456264..1456641,1456693..1456724,1456777..1456839))
Genome map
AA seq 547 aa AA seqDB search
MAQEMRYFSTRGGKETLSFEDAVLTGLAPNGGLYIPTHIPALPKDWKTRWAGLSFPELSH
EILSLFVPTSVIPSDDLRSIINTAYSSFRSPATTPIRQTGDKEYVLELWHGPTWAFKDVA
LQFLGELFRYFLERRNKGKAEDMEELTVVGATSGDTGSAAIYGLRSKPSITIFILYPDGR
VSPIQEAQMATVPDANVYCVAVEDSDFDTCQSIVKTLFSDAEFNATHRLGAINSINWARI
LAQIVYYFSAYFQLPEEARKDGAKLQFVVPTGNFGDILAGWYAKKLGLPMEQLVVATNEN
DILERFFRTGRYEADEAVQQDQTAETAAVNGSSDGQQAVSAVKATHSPAMDILLSSNFER
LLYYLALETNDTEGSDEEKRFNAQEKLNNWMSALKKDGKVDLGEDVRQAACKDFWAERVS
DGQTLEQIQKYYKREKYGPYVVDPHTAVGLTAQERSAKKASPDTTWVTLSTAHPAKFSGA
VELALSPSEFPDFDFRRDVLPDELKKLEGLEKRVHRVKGEEGVRALIEKVKSASHEKVDA
EEGRGSL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggaaatgagatacttctctacaagaggtggcaaggagaccctctccttcgag
gacgccgtcttgaccggtctcgctccgaacggcggtctctacatccccacccacatccct
gcccttcccaaagactggaagaccaggtgggctggtctttctttcccagaactttcccac
gaaatcctctccctttttgtccccacctctgtcattccctccgatgaccttcggtccatc
atcaacaccgcctacagttccttcagatcccccgccactacccctatcaggcagaccggt
gacaaggagtatgtccttgagctctggcatggtcccacatgggctttcaaggacgttgca
cttcagttcttgggagagttgttcaggtactttttggaaaggaggaacaagggcaaggct
gaggatatggaggagttgacggtcgtcggtgctactagtggtgacactggaagtgctgcc
atctacggtctccgatccaagccttccatcaccattttcatcctctaccccgacggccga
gtgtcccctatccaggaggctcagatggccaccgtccccgacgccaacgtttactgcgtc
gccgttgaggattctgactttgacacttgtcaaagcatcgtcaagaccctcttctccgat
gccgagttcaacgctactcaccgtctcggcgctatcaactctatcaactgggcccgtatc
ctcgctcagatcgtctactacttctccgcttacttccagctccccgaagaggccaggaag
gatggtgccaagcttcaattcgtggtacctactggtaactttggtgacatccttgctggc
tggtacgccaagaagctcggtctccccatggagcaactcgttgtcgccaccaacgagaac
gacattctcgaacgattcttcaggaccggcaggtacgaggcggatgaagctgtgcaacaa
gaccagaccgccgagactgctgctgtcaatggctctagcgatggacagcaagctgtcagc
gccgtcaaggcgactcactctcccgctatggacatcctcctctcttccaactttgagagg
ctgttgtactaccttgcccttgagactaacgacaccgagggatccgatgaggagaagagg
ttcaatgcccaggaaaagttgaacaactggatgagcgctttgaagaaggatggcaaggtt
gacctcggagaggatgtcaggcaggctgcctgcaaggacttctgggccgagagggtgtct
gacggccagaccctcgaacagattcaaaagtactacaagcgagagaagtacggtccttat
gtcgttgacccccacaccgccgttggtcttaccgctcaggagcgctctgccaaaaaggcc
tcccccgataccacctgggtcactctttccactgcgcaccccgccaagttctctggtgcc
gttgagctcgccctctcaccctccgagttccccgactttgacttccgacgggatgtgctt
ccagacgagctcaagaagctggaaggccttgagaagcgagttcacagggtcaagggtgag
gaaggtgtgcgtgcgctgattgaaaaggtgaagagtgcgagccatgaaaaggtggacgcc
gaagagggacgaggatctctttga

DBGET integrated database retrieval system