KEGG   Cryptococcus gattii: CGB_B6710WHelp
Entry
CGB_B6710W        CDS       T02232                                 

Definition
2-oxoglutarate metabolism-related protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgi  Cryptococcus gattii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cgi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cgi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cgi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(1505246..1505352,1505457..1505530,1505582..1505607,1505661..1505759,1505831..1506202,1506261..1506641,1506698..1506792,1506843..1506997,1507054..1507112)
Genome map
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRIALQPGANLVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEDSTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAQKEKGAGEEA
LAKHEEKAPKLDKSEAEKPAPKKQEKPAPKQEPQPEKTAGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGILKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPVVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacatcctcccgcgccatcgcttcctcttccactgctgcccttagacgctca
agtcttaggtccatctctctcgccagaaatgtctccaaaactcaaatctctcgcattgct
cttcaacctggggccaaccttgttttccgttccagtttccactcttcatctcttctcctc
gcagagaccgttaaggttccacaaatggctgagtccattacggaaggtactctgaaacaa
tggagcaagcaagtgggcgattttgtcaagcaagacgaggagattgctaccattgagacc
gacaagattgatgtctctgttaacgctcccgtttctggtactatcactgaactccttgcc
gaagaggattccaccgtcactgttggccaagatcttttgaagattgaaccaggagaaggt
ggcgctcagtcttcagagtccaagcctcaagccaaatctgagccaaagaacgctgaagag
ggcaacaaggacgaagcggcccctgccgcacagaaagagaagggagctggtgaggaagca
ctcgccaagcatgaggaaaaggcacccaagctggataagagtgaggccgagaagcccgct
cccaagaagcaggagaagcctgcccctaaacaggagcctcaacctgagaagaccgctgga
agcagaaacgagaccagggttaagatgtcccgaatgcgacagactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactacctttaacgaaattgatatgtcttcc
cttatggaattccgaaaactctacaaggatggcatcctgaagaacgagggtgtcaagctt
ggtttcatgtctgctttcgccaaggcctcttgtcttgccctcaaggaaattcccgccgct
aatgctagcattgagggcgactctatcgtttacagggattatgttgacttgtctgtcgcc
gtcgccacgcccaagggtttggtgacccctgtcgttaggaatgcggagagcatgggtctc
gtcgagattgagaaggcgattgctgacttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggaggtaccttcaccatctccaacggtggcgtcttcggttctctt
tacggtacacccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgtaatccgacctatcatggttgttgctctt
acctacgaccaccgattactcgacggccgggaagccgtcactttcctcgttcgtattaag
gaatatattgaggattccaggaggatgttgcttccctcacctatctaa

DBGET integrated database retrieval system