KEGG   Cryptococcus gattii: CGB_B6710WHelp
Entry
CGB_B6710W        CDS       T02232                                 

Definition
(RefSeq) 2-oxoglutarate metabolism-related protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00020  Citrate cycle (TCA cycle)
cgi00310  Lysine degradation
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
Module
cgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGB_B6710W
  Amino acid metabolism
   00310 Lysine degradation
    CGB_B6710W
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CGB_B6710W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-GeneID: 10187717
NCBI-ProteinID: XP_003192351
UniProt: E6R1A2
Position
B:join(1505246..1505352,1505457..1505530,1505582..1505607,1505661..1505759,1505831..1506202,1506261..1506641,1506698..1506792,1506843..1506997,1507054..1507112)
Genome map
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRIALQPGANLVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEDSTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAQKEKGAGEEA
LAKHEEKAPKLDKSEAEKPAPKKQEKPAPKQEPQPEKTAGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGILKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPVVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacatcctcccgcgccatcgcttcctcttccactgctgcccttagacgctca
agtcttaggtccatctctctcgccagaaatgtctccaaaactcaaatctctcgcattgct
cttcaacctggggccaaccttgttttccgttccagtttccactcttcatctcttctcctc
gcagagaccgttaaggttccacaaatggctgagtccattacggaaggtactctgaaacaa
tggagcaagcaagtgggcgattttgtcaagcaagacgaggagattgctaccattgagacc
gacaagattgatgtctctgttaacgctcccgtttctggtactatcactgaactccttgcc
gaagaggattccaccgtcactgttggccaagatcttttgaagattgaaccaggagaaggt
ggcgctcagtcttcagagtccaagcctcaagccaaatctgagccaaagaacgctgaagag
ggcaacaaggacgaagcggcccctgccgcacagaaagagaagggagctggtgaggaagca
ctcgccaagcatgaggaaaaggcacccaagctggataagagtgaggccgagaagcccgct
cccaagaagcaggagaagcctgcccctaaacaggagcctcaacctgagaagaccgctgga
agcagaaacgagaccagggttaagatgtcccgaatgcgacagactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactacctttaacgaaattgatatgtcttcc
cttatggaattccgaaaactctacaaggatggcatcctgaagaacgagggtgtcaagctt
ggtttcatgtctgctttcgccaaggcctcttgtcttgccctcaaggaaattcccgccgct
aatgctagcattgagggcgactctatcgtttacagggattatgttgacttgtctgtcgcc
gtcgccacgcccaagggtttggtgacccctgtcgttaggaatgcggagagcatgggtctc
gtcgagattgagaaggcgattgctgacttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggaggtaccttcaccatctccaacggtggcgtcttcggttctctt
tacggtacacccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgtaatccgacctatcatggttgttgctctt
acctacgaccaccgattactcgacggccgggaagccgtcactttcctcgttcgtattaag
gaatatattgaggattccaggaggatgttgcttccctcacctatctaa

DBGET integrated database retrieval system