KEGG   Cryptococcus gattii: CGB_B9180CHelp
Entry
CGB_B9180C        CDS       T02232                                 

Definition
(RefSeq) histone h2b
  KO
K11252  histone H2B
Organism
cgi  Cryptococcus gattii
Brite
Chromosome [BR:cgi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CGB_B9180C
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CGB_B9180C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa Bt_P21
Motif
Other DBs
NCBI-GeneID: 10188149
NCBI-ProteinID: XP_003192480
UniProt: E6R1E3
Position
B:complement(join(2021662..2021731,2021782..2021925,2021980..2022101,2022160..2022243))
Genome map
AA seq 139 aa AA seqDB search
MAPKSVASKAPASQASKAPAAASKAPAKAAKTSAAPKDGAKKRSKKRVESYSSYIYKVLK
QVHPDTGISNKAMSILNSFVSDIFERIATEASKLASYNHRSTISSREIQTSVRLILPGEL
SKHAISEGTKAVTKYSSSK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagtccgtcgcttccaaggctcctgcttctcaggcctccaaggcccccgct
gccgcgtccaaggctcctgccaaggctgccaagacttctgccgctcccaaggacggtgct
aagaagaggtccaagaagagggttgagtcttactcttcttacatttacaaggtcctcaag
caggtccaccccgacactggtatctctaacaaagccatgtctatcctcaactcttttgtc
tccgacattttcgagcgaattgccactgaggcttccaagcttgcttcttacaaccaccga
tctaccatctcttctcgagagatccagacctctgttcgactcatccttcctggtgaactc
tccaagcacgctatctctgagggtaccaaggccgtcaccaagtactcttcttccaagtaa

DBGET integrated database retrieval system