KEGG   Cryptococcus gattii: CGB_C0630CHelp
Entry
CGB_C0630C        CDS       T02232                                 

Definition
mitogen-activated protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cgi  Cryptococcus gattii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CGB_C0630C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CGB_C0630C
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CGB_C0630C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(170860..170942,171016..171447,171507..171811,171868..172041,172159..172226,172414..172449))
Genome map
AA seq 365 aa AA seqDB search
MADFVKLSIFGTVFEVTTRYVDLQPVGMGAFGLVCSAKDQLSGTSVAIKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
IASENTLRFVQSLPKREKVPFSTKFPNADPVSLDLLEKMLVFDPRTRISAAEGLAHEYLA
PYHDPTDEPVAAEVFDWSFNDADLPVDTWKVMMYSEILDFHNLGDISQNEAEGPVTGEVS
AAPAS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccgattttgtcaagctctccatctttggaaccgtttttgaggttaccacgcgttat
gtcgacctccaacctgttggtatgggcgcttttggtctcgtctgttccgccaaagatcag
ctctctggaacttctgtggctatcaagaagattatgaagcccttttcaacccccgttctt
tccaagaggacttatcgagaactcaagcttctcaagcatttgagacatgagaacattatc
tctcttagtgacattttcatttcacctctcgaagatatctactttgtcaccgagcttctc
ggtaccgaccttcatcgactccttacctctcgccctcttgagaaacaattcatccaatac
ttcctttaccaaatcctccgtggtctcaagtatgtccattctgccggtgtggtccaccga
gacctgaagccgtcaaacattctcgtcaacgagaactgtgacttgaaaatttgtgacttt
ggccttgcgaggatccaagaccctcagatgactggttatgtttccacgaggtattaccga
gcacctgagatcatgttgacatggcaaaagtatgatgtcgcggttgacatttggagtacc
ggttgtatctttgcggagatgctggagggcaagccattattccctggaaaggatcacgtg
aaccaattctcaatcatcaccgaattgcttggtaccccgccggacgatgtcatccaaact
attgcctctgaaaacacgcttcgctttgtccagagtctgcccaagcgcgaaaaggtccca
ttttccaccaagttccccaatgccgatcctgtttctcttgatttgttagagaagatgctg
gtgtttgaccctcgtacccgtatatccgccgcggagggtctcgcgcacgagtacctcgcg
ccgtaccacgatcctaccgatgagcctgttgctgcagaggtgtttgattggagttttaac
gatgcggatttgccggtggatacgtggaaggtgatgatgtatagtgaaatccttgatttc
cacaacctcggcgatatttcccagaacgaagcagaggggcctgtcactggcgaagtctcg
gctgctcctgctagctag

DBGET integrated database retrieval system