KEGG   Cryptococcus gattii: CGB_C1310CHelp
Entry
CGB_C1310C        CDS       T02232                                 

Definition
histone deacetylase clr3
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
cgi  Cryptococcus gattii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(281603..281814,281895..281982,282073..282333,282413..282508,282585..282651,282721..282777,282882..283038,283131..283320,283397..283524,283593..283705,283761..283913,283969..284257,284324..284717))
Genome map
AA seq 734 aa AA seqDB search
MANTNAMDIDTPPIASTSAQQLNSVQTPIRTTPVTTMSMPGAAARIARTGYIYDPLMMLH
CMEGYMPTAENVMDNGDGHPEDPMRIKRIFTRLAEQGLIRRMKRLDFEEVTFEQVLLVHG
EEMWDKVQATELLTDQQIQDTKEYYDQLSLYVCRETAHCARLSAGGVIQTCRSVCKNEVR
NAFAIVRPPGHHAEPNEHMGFCFFNNVAVATREMQREGLAKKVLILDWDVHHGNGTQRAF
WHDGDVLYMSLHRHEGGTFYPNGDFGSLNMVGDGEGVGKSVNIPWPGPGFGDADYIYAFQ
RIIMPIAYEFNPDLVIISAGFDAADGDMLGQCHVTPAAYGHMTHMLSSLAGGKLVVALEG
GYNLRAISDSALAVARVLLGEIPPELGILRASQAATEVVYQVALEQSKYWECIDVKACEP
PEVIELENGTSPVYTIPDLLKIHRAHHMFTKHQLYQIPLASQELEAAFGGQIICNENMYE
VGEKGVLVVFVHDFGNLRVENDGARSTNIHLANSYLLDTSDAVVSWIKKRGYNIIDVNIL
KQLPTEYPEGPKMIVKQANDMESKLMKYIWDNYIELSECEKVVFIGHGTGCQAIMDLVNA
RDVEFKVKAVVQVAGLHSLVRPNPSNKEKLSWFKQCNQIYVPAEHVVLGDEKVKRRLGDA
VFTSQKAKVVDVLNDVLPRIKAFVESKVEDGLPPRAHSGSDGLYGLGGRDLVAVNGHVHV
DDVANTGTEAEATT
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacacaaacgccatggacattgacacaccacccatcgcctcgacctcggcgcag
caactcaattccgtacaaacacctatacgcactacccctgttactaccatgtccatgcca
ggagcagcagcacggatagcccgtacgggttacatttacgacccactcatgatgttacat
tgcatggaaggttacatgcctactgcagagaatgtgatggataacggtgatggacatcca
gaagatcccatgaggatcaagaggatctttacgaggttggccgagcaagggttgatcagg
agaatgaagaggttggattttgaagaggtcacgtttgagcaagtgttgttggtgcatggc
gaggagatgtgggataaagtgcaagctacagagttgttgaccgaccagcaaattcaagat
accaaagagtactacgatcagctatccctctacgtctgccgcgaaaccgcccattgtgct
cgtctttctgcgggaggtgtcattcaaacatgtcgatcagtgtgcaagaatgaagtgcgt
aatgcctttgctatcgtacgtcctccgggccaccatgcagaacccaacgaacatatgggt
ttctgtttcttcaacaatgttgcggtggctaccagggagatgcagagggaaggcttggcc
aaaaaggtgttgatcttggattgggatgttcaccatggtaatggtacacaaagagcgttt
tggcatgatggtgatgtgctttacatgtcattacatagacatgaaggaggtacattctac
cccaacggcgatttcggatctctcaacatggtcggtgatggtgaaggtgtcggcaagtct
gtcaacatcccttggcctggaccaggcttcggtgatgccgattacatttatgcattccag
cggatcatcatgccaatagcatacgagtttaatcccgacctcgtcatcatttctgccgga
ttcgatgctgctgacggagacatgctcggtcaatgtcatgtcacgcctgcagcttacggc
catatgacacatatgctcagttcattggctggtggcaagcttgtcgtcgcccttgaaggt
ggatataatctccgagccatatctgattccgctctcgccgtcgcccgtgtcctcctgggt
gagatcccacccgagctaggtatcttgcgagcatcccaagccgctaccgaggtggtctac
caggtcgcgcttgaacagagcaaatactgggagtgcatcgatgtaaaggcttgtgaaccg
cctgaagttatcgagcttgaaaatggcacttctcctgtctatacaatcccggacctactt
aaaattcatcgcgcgcaccacatgtttaccaaacaccagttgtatcaaataccgctggct
agccaagaattggaagctgcattcggtggtcaaatcatctgcaatgaaaacatgtatgaa
gttggagaaaagggggtattggtggtgtttgtccatgacttcggtaacttgagagttgag
aatgacggcgcgagatctaccaatatccacctggcgaacagctaccttctcgatacgagt
gatgcagttgtatcgtggattaaaaaaagaggctataacattatcgatgtcaatatccta
aaacaattacctaccgaatatcctgaaggccccaagatgatcgtgaaacaagccaacgac
atggaatccaaattaatgaaatatatctgggacaattatattgaactgtctgaatgcgaa
aaagtagtgttcatagggcacggtacaggctgtcaagcaattatggatcttgtcaatgct
agagacgtagagtttaaggtgaaggctgtggtgcaagtggccgggttacattccttggtc
agaccgaatccgtcaaataaggaaaagttaagctggttcaagcagtgtaatcaaatctac
gtgcctgccgagcatgtggtattgggggatgaaaaggtgaagcggagattaggtgacgca
gtgtttacttctcaaaaagctaaagtagtcgacgtccttaacgatgtccttccacgaatc
aaggcctttgtcgaatccaaggttgaagatggccttccgccgcgagcgcattcgggttca
gacgggttgtacggtttgggaggtagagatttggtggccgttaatggacatgtacatgtg
gatgatgtggcgaatacaggaacagaggcggaagccaccacataa

DBGET integrated database retrieval system