KEGG   Cryptococcus gattii: CGB_C3420CHelp
Entry
CGB_C3420C        CDS       T02232                                 

Definition
MAP kinase kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CGB_C3420C
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CGB_C3420C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(722350..722436,722495..722887,722940..723064,723157..723278,723330..723484,723535..724041))
Genome map
AA seq 462 aa AA seqDB search
MYPQNSSDPSSYSPSTFSLPKSSISRKKPPGLDISKSILRPTRTAPVLPSNGSSPGNFVS
EADKLRDDIANLQLSSRSTGSSHSVEALDSPRAFQSDSSVASGPAKKEKSRDGKERGDKE
KRKKRHKDKDGEDLVKDEDLEVLHDLGAGNGGTVTKVWNKKRKCIMARKLILVDAKPSIR
KQILRELQIMNDCDSPYIVGYYGCFPVDVHVGIVMEFMDAGSLDYIYRHHGAIDIDIVGK
VAEAVLEGLIYLYDKHRIIHRDIKPSNVLANTRGEIKICDFGVSGELINSIANTFVGTST
YMSPERIQGAPYTIKSDIWSLGISLIELAVGRFPFSDSPDSEELSPSASDFDPDPTLPRS
VRRPKIESNSGRNGVSQSGGPHAMSILDLLQHIVNEPAPRLASRRRTFPQEAVAFVEGCL
IKDPDQRRSPRELLSSPWITNLKTTKEDLQAWAQSVTSSREE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgcaaaattcctcagatccttcatcctactccccttccactttctctcttccc
aaatcctccatctcacggaagaaacctccgggactcgacatctccaaatccatccttcgc
cccacacgtactgccccggttctgccctcaaacggaagctcccctggcaactttgtatca
gaagcagacaagcttagagatgatattgccaacctccaactgtcaagtcgatcaaccggc
tcgagtcactccgtggaagcactcgactcccctagggccttccagagcgacagttcagtt
gcgtcgggtcctgcaaagaaggagaaaagtagagacggtaaagaacggggtgataaggag
aaaaggaagaaaagacacaaggataaggacggagaggacttggtcaaggacgaggaccta
gaagtactgcacgatttgggagccggcaacggtgggacagtgactaaagtgtggaataag
aagagaaaatgcattatggctcgaaagctcatccttgtagacgccaaaccatccataaga
aaacagattcttcgagagttacaaatcatgaacgactgtgattctccatacatcgttgga
tattatggatgctttcccgtcgacgtccatgtaggaattgtcatggaattcatggatgct
ggatctctggactacatctacaggcatcacggcgccattgacatcgacattgtcggtaaa
gtcgctgaagcggtgttggagggtctgatttatctttatgataaacaccgcatcatacat
cgagatatcaagccgtccaatgtattagccaacactcgaggggagataaagatatgtgat
ttcggagtctctggggagttgatcaactcgattgccaatacatttgtgggcacaagcaca
tacatgagccccgagcgaatccagggggcgccgtacacaatcaaatcagatatctggtcc
ctcggtatctcccttatcgagttggctgtcggccgcttcccattctccgactcacccgac
tctgaagaactttcacctagcgcttccgactttgatcctgatcctacacttcctcggtcc
gttcgacgccctaaaattgaatctaacagcggacgtaacggcgtcagtcagagcggtgga
ccgcatgccatgtctattcttgatttgttgcaacatatcgtcaatgaaccagccccaaga
ttggcgagcaggcgaaggacattccctcaggaggccgttgcgtttgtagaaggctgcttg
atcaaagatcccgatcaaagaaggagtccaagagagctgctgtcttctccatggataacc
aacctcaaaaccaccaaagaggaccttcaagcctgggctcaatctgtgacgagctcacgt
gaggaatag

DBGET integrated database retrieval system