KEGG   Cryptococcus gattii: CGB_C5050WHelp
Entry
CGB_C5050W        CDS       T02232                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
cgi  Cryptococcus gattii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CGB_C5050W
Translation factors [BR:cgi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CGB_C5050W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:join(990614..990832,990889..991113,991161..991277,991328..991443,991512..991734)
Genome map
AA seq 299 aa AA seqDB search
MSSTAIPPAAVSANNNALNSALAAEQISSPASPIDKPEDEKKQLEEGEIEENSSEGDSQA
KTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAMPQGSHGWMADIRKVVSFD
SVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQNKNGGKWSIQVPKNSESKGSI
DRMWLYTMLAAIGETFETPSTDSENAPSPIQSDLITGVIVSPRPAFYRISIWTREASDVN
VPDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGFQTELTFDAHKDSEKKVNKNKFTV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaacagccataccccctgcagcggtctcagccaacaacaatgctctcaatagc
gctctcgccgctgaacaaatttcaagtcccgcttcaccaatcgacaagcccgaagacgaa
aagaaacagctcgaagaaggcgagattgaagagaactcttcggaaggcgactctcaagca
aagaccatttttgacgatgccagtaaatttaatgtcaagcaccccttgttttctacctgg
actctttacttcgactccccgcaatcaaaatctctccccaaaacaccccagactacccca
gctatgcctcagggctcccatggctggatggcggatatcagaaaggtcgtatcgttcgac
agtgtagaagaattctggggtctctacaacaacatcattcctccctctcagcttcctggt
aaggccaactattatctgttcaagaatggcattatcccggcctgggaggaccctcaaaac
aagaatggtggaaaatggtctattcaggtacccaagaatagcgaaagcaagggatcaatt
gacagaatgtggctgtatacgatgcttgctgcgattggcgaaactttcgagacaccctct
accgactctgaaaatgccccttcccccattcaatcagatctcatcaccggtgtgatcgtc
tcccctcgtcctgccttctatcgaatttccatttggactcgcgaggccagcgatgttaac
gttcccgacactgatgcgatcaaggcacgtctgctcaacatcggcaaacacttcaagaca
agtgttttagggtacgaacttgagcaaaagctcacagagggaggattccaaacagagctc
actttcgatgctcataaagattctgaaaagaaggtgaacaaaaacaaattcactgtgtaa

DBGET integrated database retrieval system