KEGG   Cryptococcus gattii: CGB_C5570CHelp
Entry
CGB_C5570C        CDS       T02232                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgi  Cryptococcus gattii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGB_C5570C
   00052 Galactose metabolism
    CGB_C5570C
   00500 Starch and sucrose metabolism
    CGB_C5570C
   00520 Amino sugar and nucleotide sugar metabolism
    CGB_C5570C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CGB_C5570C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(1135690..1136020,1136070..1136134,1136187..1136338,1136384..1136658,1136710..1136951,1137010..1137217,1137267..1137343,1137480..1137575,1137681..1137746))
Genome map
AA seq 503 aa AA seqDB search
MATLEPKQDPQASARQRGHSAVDFKSATTGVAAKTMRNELNRMVANEQDPAKKKVFEAEM
QSFFILFNRFLTERAKGEKLDWEKINPPKPEQVRPYKALPNVDPSILNKLAVLKLNGGLG
TTMGCVGPKSIIEVRDNMTFLDLSVRQIEHLNEKYNVNVPFILMNSFNTDEDTARIIQKY
QNHNINILTFNQSRYPRVDKESLLPCPQESSSDKSNWYPPGHGDIFDALTNSGLLDKLIA
AGKEYIFISNVDNLGAVVDLNIFQTMIDAQAEYVMEVTDKTKADVKGGTIIDYDGKPRLL
EVAQVPKDHLDEFCSTRKFKIFNTNNIWCNLRAIKRIMDEDALSLEIIVNNKVTDAGQAV
IQLETAIGAAIKHFDSAIGINVPRSRFLPVKSCSDLLLIKSKLYNLEHGVLTMDRSREFG
GTPVVKLGGEFKKVANFEKRFKSIPNITELDHLTVSGDVWFGKSVRLAGTCIIVATEGNK
IMIPDGTNLENKLITGNLSIIDH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctactctcgaacccaagcaggatccccaggcctccgccaggcagaggggccactca
gcagtcgacttcaaatctgccaccactggcgtcgctgccaagaccatgagaaacgagctc
aacagaatggttgccaacgagcaagaccctgctaagaagaaagtgtttgaggctgagatg
cagtccttcttcatcctcttcaatcgtttcctcactgagcgtgccaagggcgaaaagctt
gactgggaaaagatcaacccccccaagcctgaacaggtccgcccttacaaagcccttccc
aacgttgacccttctatcctcaacaagcttgctgttctcaagctcaacggtggtctcggt
accactatgggctgtgtcggccccaagtcaatcatcgaggtcagggataacatgactttc
ctcgatctttctgtccgacaaattgaacatttgaacgaaaagtacaatgtgaatgtgccc
ttcatcctcatgaactctttcaacaccgatgaagacacagctaggatcattcaaaaatac
cagaaccacaacatcaatatcctcacttttaatcaatctcgataccctcgtgtcgacaag
gaatctctgcttccttgccctcaagaatcttccagtgataagagcaactggtaccctccc
ggacatggtgacatctttgatgctttgaccaactcgggccttcttgacaagctcattgct
gcaggcaaggagtacatcttcatctccaacgtcgacaatcttggtgctgtcgtcgatctc
aacatcttccagaccatgattgacgctcaggccgaatacgttatggaggtcactgacaag
accaaggccgacgtcaagggtggtaccatcattgactacgatggcaagcctaggttgctc
gaggttgcgcaagttcccaaggatcaccttgatgagttctgcagcactcgaaaattcaag
atcttcaacaccaacaacatttggtgtaatttgcgagccatcaagaggatcatggacgag
gatgcgctcagtcttgaaatcattgtcaacaacaaggttactgatgctggccaagccgtt
atccaacttgaaactgccatcggtgccgctattaagcatttcgactcggccatcggcatc
aacgttcctcgatcacgattcttgcctgtgaagtcttgctctgatcttctcctcatcaag
tccaagctctacaaccttgagcacggtgttttgaccatggacagatcccgagaattcgga
ggcacccctgttgtcaagcttggtggcgagttcaagaaggttgccaactttgagaagcgt
ttcaagtctatccccaacatcaccgagctcgaccatcttactgtttctggcgatgtctgg
ttcggtaagagtgtgaggcttgctggtacctgtatcattgtcgctactgagggcaacaaa
atcatgattcccgacggtaccaacctcgagaacaagttgattactggtaacctttcaatc
attgatcactaa

DBGET integrated database retrieval system