KEGG   Cryptococcus gattii: CGB_C5580CHelp
Entry
CGB_C5580C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cgi  Cryptococcus gattii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CGB_C5580C
Enzymes [BR:cgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CGB_C5580C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(1138596..1138700,1138746..1139013,1139061..1140113,1140188..1140772,1140833..1140846,1140928..1140972,1141018..1141074,1141125..1141569,1141628..1141693,1141732..1141778,1141839..1142069))
Genome map
AA seq 971 aa AA seqDB search
MSRSTMSRQPTGDSTPARDLLLPHPAEDLSADDDLLSWVLVDQLGCMPNTKLGVHPQQVK
FVGPPFKTDEVLNIVRETVTKGDLHAAMKRLQEFWLFQQHLQSKLTTNQKERFIQHLRRY
LLCLQPTSRVEIHLTSRYSFVTGHTELAVFATRPLARGLVVQELQGSVVPLPDEWREEMD
IGDDFAVEAAEESDSERDEEEEDVDSGAITSTSGRRGKSKTKEECRRQGQRRSDRTKRRD
FSIVWSGLKRCYQLFLGPARFLNHDCNPNVELLRQGNYVTFRWVYIMLEWKPKLMIALVK
GILCLTCEKNHRGGFAPKPESSRRTSRDLSRDFTVDPVCIRGRSSVSRSRKSISAGPQPL
KYEGAVKQEPFSDDEQAVSVGLSTAASLSTEEECETPIDNVSNIPSVASPFGESLASDVD
SVLMPPRRERYARKAAQNSKSWLLLKGRGSKTHVDENLAFVGDEEEVPPDFPRCATCAKP
LSDQIWYNGRYFDHCQRCVRHALVFQLPWPAHKPQEVQEYPPAYLIPPGYIPPKISTVPL
PSLSKNKPAPRVNPIATAPTPPRAGSSMEDRAHRLRKQIEIEEFIVNSLREAAWSVQEAK
ELAQEAKEEARRKKKEEKMRLDAMRIKGNGVWQRYEYVDEEELKRKQEAMWRVEPGTTRR
GTVRKTPQVENNNEKKEKQTGKEADGTLTAITDEARAKKNEEKRRKRAEEKLKREQKMRE
EERKKEEKKLKDRERKRRAKEMRKEEKDRLVQTALSNYTSTSQRDNGYAQPSVDIDEEDN
EDLEDEIMVATAPELVAYYSPEMPKATELPSSAIIPARPLARRISKGTSQSPLSSGFKVL
TNSPQTIMRTGFCSPSSYHASHSCSRLPTQGLCFIKPKRKRHPGTVKTLRDQTTEAAPAI
SEQEKSEKDCGMSLTLVGSSQMGKENSLLKEDKEKGMSPASHSAKSIISAMEFTKQTAVI
SQELPSGAYGG
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggagcaccatgtctcgccaacccactggcgattccaccccagcacgagatctg
ctcttgccgcaccccgccgaggatttatcggctgatgatgatctattgtcatgggtgctt
gttgatcagcttggctgtatgccaaacacaaaacttggagtacatcctcaacaagtgaaa
ttcgtggggcctccgttcaagactgatgaggtgcttaacattgttagggagaccgtaacc
aaaggggacctgcatgcggctatgaaaagacttcaagaattttggttgtttcaacagcat
ctgcaaagtaagcttacgacgaaccagaaggaacgcttcattcaacatctacgtcggtat
ctgctgtgtctccagcccacatcccgggtggaaatccacctgacttctcgctattctttt
gtcacaggccataccgagcttgctgtatttgctacgcgtccgctcgcccgaggcctagtt
gttcaagagcttcaaggtagtgttgtaccgcttccggacgaatggcgtgaggagatggac
attggcgatgactttgcggttgaagctgctgaagaatcagactcggagcgagacgaggaa
gaagaagacgtcgactcaggagcaattacctctacttctggtagaagagggaaaagcaag
acaaaggaagagtgcagacggcaaggtcaaagaagaagcgataggacgaagagaagagat
ttcagcatagtctggtccggattgaagcggtgctaccaactattcttgggcccagcgaga
tttttgaatcacgactgcaatccaaatgtcgaattattgagacaagggaactatgtcacc
ttccgctgggtttatattatgcttgaatggaaacctaaactgatgattgcgttggtaaag
ggaattctttgcctcacctgcgagaagaatcatcgcggtggctttgctccgaagccagaa
agctcgaggcgtacttctcgggatttgtctcgtgatttcaccgttgatcccgtttgcatc
agaggcagatcatcggtatctcgttctcgaaaatcgattagtgccggaccgcaacctttg
aaatatgaaggagcagtcaagcaagagccattctccgatgacgagcaagcagtatccgtt
gggttatcaactgcggcctcactctctacggaagaggagtgtgagacaccaatcgacaat
gtctctaatattccgtctgtggcctctccatttggagagagtcttgcttcagatgtcgac
tcagttcttatgccaccacgcagagagcgctatgcacgcaaagctgctcagaactccaaa
tcttggctcttgttgaagggccgagggtcgaagacccacgtagacgaaaatcttgccttt
gtaggagatgaggaggaggttccacccgattttccacgatgcgccacatgtgccaagccc
ctgagcgatcaaatatggtacaacggaagatattttgatcactgccaaagatgtgtacgc
catgctcttgtgtttcaacttccatggccagcccacaagccccaggaagtgcaggagtac
cctcctgcttacctcatccctcccggttacattcctccgaaaatttccaccgttcctctg
ccatcactgagcaagaataaaccggcccctcgtgtcaaccctattgctacagccccgaca
ccacccagagcggggagttcaatggaagaccgggcgcatcgattgcgcaagcagattgaa
atagaagagtttattgttaattcattgcgtgaggcggcctggtctgtgcaggaagcgaaa
gagttggctcaagaagctaaagaagaggcgagaaggaagaaaaaagaggagaaaatgaga
ttagacgccatgagaataaaaggaaatggcgtttggcagaggtacgaatatgtggacgaa
gaggaattgaaaagaaagcaagaggcaatgtggcgcgtggaacctgggactacgcggagg
ggaacagtcaggaaaacccctcaggtcgagaacaacaatgagaaaaaggaaaagcagact
ggaaaagaggccgatggtacacttacagctattacggatgaagcccgcgcaaaaaagaac
gaggaaaaacggcgaaagagagctgaggagaaattaaaaagagaacagaagatgcgagaa
gaggagagaaaaaaagaggagaagaagttgaaggatagagaaaggaagcggcgagccaaa
gagatgaggaaagaggaaaaggataggttggtgcaaactgcactttccaactatacatcc
acttcccaaagggacaacggttatgcccaaccctcagttgatattgacgaggaagacaat
gaggatctcgaagatgaaatcatggtggcaactgctcccgaactagtggcatactactct
ccggagatgccaaaagcgaccgagttgccatcatcggctatcattcccgctcgtcctttg
gctcgccgaatctcaaagggcacctcacaatcccctctatcttcaggattcaaggtcctc
actaactcgccccaaactattatgcggaccggcttctgctccccgtcaagctatcatgct
tcacattcctgctcgcggcttcccacccaaggactctgcttcatcaagccgaaaagaaaa
agacatcctggaacagtcaaaacattaagagatcagacgaccgaggccgcccccgcgata
tcagaacaagagaagagtgagaaagattgtggaatgtcactaacacttgtgggcagcagt
caaatgggaaaagaaaatagtttgttgaaggaagacaaggagaaaggaatgagccccgcg
tctcattcggctaagtcaatcatttctgccatggaattcacaaagcagacggcggttatt
tcccaggagcttccttctggggcgtacggaggataa

DBGET integrated database retrieval system