KEGG   Cryptococcus gattii: CGB_C6020WHelp
Entry
CGB_C6020W        CDS       T02232                                 

Definition
DNA repair protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cgi  Cryptococcus gattii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CGB_C6020W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CGB_C6020W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:join(1180363..1180700,1180751..1180776,1180840..1180912,1180961..1181062,1181111..1181515,1181564..1181642,1181696..1181813,1181862..1181892,1181953..1182021,1182071..1182105,1182540..1182724,1182776..1182848,1182896..1183015,1183060..1183094,1183149..1183537,1183588..1183620,1183675..1183716,1183775..1183923,1183984..1184049,1184100..1184269,1184335..1184355,1184413..1184835)
Genome map
AA seq 993 aa AA seqDB search
MTISMARPRRSLGAIIDSIPSQQEYVPDSCSENSDSDSGREALIPTLKPIPLTPLPSRPT
RSTRELGPESITTVKGKEREEAGAVFGDGKKDKKVHATDDTLSMPVLYFAVQWRKPQFKK
HKTWDGDANIKVEDNRIVMLDEDGNQMATTNVGDKVIKPEAEFKIGGYEVMVDHALQQDQ
FKASTSILNRPKVIPTIKSSGYRPASFTKAFRPPIQKEKFTSTKLSTIEAVEDEHRQSPI
SSLPKRSIPTPAAAQRAVAASSFYTKQSSKPYSERIVLGEKSNKERLEWGGALFNPHAEG
AVVMPRPAEKLAKLKGTTIVDVVIDPILGNLLREHQKEGVKFMYSCVMGMTGAEGEGCIL
ADEMGLGKTLQTIALIYTMLKQSPFANQTSIIGKAIIVCPVTLVNNWRKEFKKWVDRRVN
VLVADVLSGTPVQNDLGEYWAMVDFACPGVLGKYSAFAKHYEKPILKSRTPNCSTKDVEL
GRERANDLAKLSKEFVLRRTAAVLEHYLPPKYEYVIFVAPSLLQLRVLSNLLDPSIVGSF
IRGHGAQSLALIDLMRKISNSPMLLKRKDDELARADDDLGSATSAAISAIPGDTNINDVT
TSGKMLLLDKMLHSIYQSTEEKVVVVSNWTSTLDLIQGLCKLKRYNYLRLDGSTPPKQRQ
ELVDRFNKDKERQGSFVFLLSAKAGGVGLNLIGGSRLILFDSDWNPSTDLQAMARIHRDG
QKRPVYIYRLLTTNAIDEKIYQRQITKTGLSDQMMDHKHSEKQTGKDSFSAAELRDIFTL
NVRTDGCQTHDLLGCQCTETPAGKLRDIAEGEQRSEHLPDNSSGESDSDPNDYPTFVSAN
KYDPEPTPKMRRKAIKEQKNKLAALKHWAHFDPFELASFRGIQDSLLYNVLFDSWETDGV
PLSENVRAYGSLDFEGPYEQDEDDPDSDNEALVPKKRKLGMVQTTAALKKTRTTDEEDTR
FNQRRRNLKSIAESGGTGRVTFVFEKISKSTIA
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcagcatggccaggcccaggcgcagcctcggtgccatcatagactcaatccct
agtcaacaggaatatgttccagactcttgctcagaaaactccgattccgattcaggacga
gaagctctcattccaaccctcaaacctataccactcacacctttgccctccaggccaaca
cgctctacccgcgaactagggcctgaatcgataacaacggtgaaagggaaagaaagagag
gaggctggagctgtttttggtgacggcaaaaaagataaaaaggtccatgcgaccgatgac
accttatcaatgccggtcctgtatttcgccgtgcaatggaggaaaccccagtttaagaag
cataaaacatgggatggcgatgccaacataaaggttgaagataataggattgtaatgctt
gacgaggatggaaatcaaatggccactaccaatgttggagataaagtcattaagccggag
gccgaattcaagatcggtggatatgaggtcatggtagatcatgcgcttcaacaggatcaa
ttcaaagctagtaccagtatcctcaatagacctaaagttatcccaacgatcaagagctcc
ggctaccgacctgcatcattcacaaaggcctttagaccgccaatccagaaagagaaattt
acttcaacaaagctctcaaccatagaggctgttgaagatgaacaccgccagtcacccatt
tcttcacttccaaagcgctccattccaacacccgcagccgcccaacgagcggttgctgct
tcatcattctatacgaaacagtcatctaaaccctacagtgaaagaattgttttgggagag
aagagcaacaaggagaggctagaatgggggggagctttattcaaccctcatgctgaaggt
gcagtggtgatgcccaggcctgcagaaaagctggctaaattgaagggcacaaccatcgta
gatgtggttattgaccccatcttggggaacttattgcgtgaacatcagaaagaaggcgtc
aaatttatgtactcgtgtgtcatgggaatgaccggtgcggaaggcgagggatgcattctt
gcggatgagatgggtttgggcaagacactccagaccatcgcactcatttacaccatgctg
aagcagtctcccttcgccaaccaaacgtccattatcggcaaggcgattattgtgtgtccg
gtaacgttggtgaacaattggcgcaaggagttcaagaaatgggtggatagaagagtcaat
gttttggtggccgatgtcttatcaggcacgcccgtacaaaacgatctgggtgaatattgg
gcgatggtcgattttgcttgtccgggtgtgttgggcaaatactcggctttcgcaaagcat
tatgaaaagccaatattaaaaagcagaacaccgaactgttcgacaaaggatgtagagcta
ggaagggaaagggcgaatgacttagccaagttgtccaaggaatttgtcctgcgaaggacg
gctgcagtacttgaacattatttgcctcccaagtacgagtacgtcattttcgtcgctcca
tcccttcttcaacttcgtgtcctttcaaaccttctcgaccccagtatcgttgggagcttc
atccgaggccatggtgcacagtcattagctctaattgatcttatgaggaaaatttccaat
tctcctatgcttttgaaacgaaaagacgacgaattagcacgagcagatgatgatttaggc
tcagccacctccgcagcaatctctgctatccctggcgataccaatatcaacgacgtgact
acgtctggcaagatgcttttgcttgacaaaatgcttcattccatctaccaatccactgaa
gaaaaggttgttgtcgtatccaactggacttctactcttgatttgatccaaggattgtgt
aagctaaagagatataactatctcagacttgatggtagtactccgccgaagcagaggcaa
gagttagttgatagattcaacaaagataaggaaagacaaggaagttttgtttttctgctt
agtgccaaagctggcggagtgggactgaacctgattggtggatcgagattgattttgttc
gacagcgattggaatccctctactgatctccaagctatggcccggatacatcgcgacggg
caaaagcgcccagtctacatctatcgccttctcacaacgaatgctatcgacgagaaaatt
tatcaacgtcagattactaagacgggattatcggatcagatgatggatcacaagcattca
gagaaacagacgggcaaagactctttctcggcagcagagttgagggacatttttacccta
aatgtgcgaacggacggttgccaaacacatgacttgctgggctgtcagtgcacggaaact
cctgcaggcaagttgagggacattgccgaaggggagcaacgttcagagcacctgccagat
aactcgtctggagagagtgatagtgatccaaacgattaccccacttttgtcagtgccaat
aaatatgatcccgaacccactcccaaaatgcgtcgcaaggcaattaaagagcagaaaaac
aagctcgctgcgctaaaacactgggctcattttgatcctttcgaactcgcatccttccgt
ggcatccaagactctctcctgtacaacgtacttttcgattcatgggagaccgatggtgtc
cctttatctgaaaacgtcagagcgtatggctctctggacttcgagggtccctatgaacag
gatgaggatgaccctgactcggataacgaggcgttagtgcctaaaaaacgcaaattgggt
atggttcaaactacagccgcgctgaagaagacaaggactacggacgaggaagatacgagg
ttcaatcaaagaaggcgcaatctgaaaagcatcgcggaaagcggaggaactgggagagtg
acatttgtatttgagaagatatcaaagagtactatagcctaa

DBGET integrated database retrieval system