KEGG   Cryptococcus gattii: CGB_C7130WHelp
Entry
CGB_C7130W        CDS       T02232                                 

Definition
(RefSeq) phosphoinositide phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00562  Inositol phosphate metabolism
cgi01100  Metabolic pathways
cgi04070  Phosphatidylinositol signaling system
cgi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CGB_C7130W
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CGB_C7130W
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CGB_C7130W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CGB_C7130W
Membrane trafficking [BR:cgi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    CGB_C7130W
 Endocytosis
  Macropinocytosis
   Phospholipase C
    CGB_C7130W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 GDPD DUF2591
Motif
Other DBs
NCBI-GeneID: 10187997
NCBI-ProteinID: XP_003192997
UniProt: E6R1W8
Position
C:join(1411734..1411946,1412014..1412410,1412460..1412746,1412807..1413688)
Genome map
AA seq 592 aa AA seqDB search
MIALTDEIYFLWIKTLKQLVSITLDRQVTDITPSDPDMLWIRQLWPLGTKAINREKAEAL
CAQIGLQIKADGMLDIKAFHELIKASQTRPDINLVYRDLTMSGPLDEGRVIAFLTHVQHI
SPSSAEELFNKYKSEDLWTIDSLTSFFSSSDNTPNQTQDMTHPLQHYFISSSHNTYLVGE
QWKGESTVEGYIRVLLAGCRCVEMDVQSGDVEPVVYHRKTLTSSVPVRDICRAIKQYGFV
TSPYPIIISTEIHCVPEQQNRLAAILKEVFGDMLVSTPLVEEFSDLPSPEDLKGKILFKA
KPPKPEPNSPKLESNFVYQESPSSTDSDTSFVRLARRLSIQSKAERPDIFSPRLSELLVY
THGVKYRGFSKLNEYLPSHQFSVSERTAAKILKENKADWIKHNFKHISRVYPRGTRLGST
NYNPVDAWSAGCQIVALNWQTLDESILLNHAMFHGSNGYILKPLALREKVVEKPERYLLT
VRIISGQRTPLFADLYVEATLNGKISKRTRTLSQVTLNPLWDEILTFEITTTPSSLMLNF
LHLEVRNKTLQAQWMRPVGLAPQGYHHLPLYDSLLSRFVFATLFVEITIKKL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttaccgatgagatatatttcctttggatcaagacgttgaagcagctggtc
tctatcactctggatcgccaggttaccgacatcacgccatctgacccagatatgctctgg
attagacagttatggcctctaggcaccaaagccattaatcgtgagaaggccgaagcgtta
tgcgcgcagatcggattgcaaatcaaagccgatggtatgctagacatcaaagccttccat
gaacttattaaggctagccagactcgacctgacattaatctggtttaccgcgacctcacc
atgagtggtcctctagatgagggacgcgttatcgcttttcttacacatgtacaacatatt
tcaccttcttctgccgaggaactgttcaacaagtataagtctgaagatttgtggaccata
gactctctgacctccttcttctcctcgtccgacaatactcctaatcaaacccaggatatg
actcatcctcttcaacactatttcatctcgagttcgcacaatacatatcttgtgggagag
caatggaaaggtgagagtacagtggagggttatattcgtgtgttgttggcaggttgtcga
tgtgtagagatggatgtgcaatctggtgatgttgaacctgtcgtgtaccatcgtaaaact
ttgacatcgagtgtgccagtccgagacatctgccgtgccattaagcagtatggttttgtg
acatcgccctatcctataattatctccactgagattcactgcgtcccagagcagcaaaac
cgattagcagccatattaaaggaagtttttggtgatatgctggtttccacgcctctggtt
gaagaattttcggacctgcctagtcctgaagatttgaagggcaaaattctcttcaaggcc
aaacctcccaaacccgaaccaaattcaccaaaactcgaaagcaacttcgtctatcaagag
tcaccttcatccactgattccgatactagtttcgttcgtcttgctcgccgtctttcaata
caatccaaggccgaacgcccggacatcttttccccccggctttcagaacttctcgtctat
actcatggtgtaaagtatcgaggcttttccaaactcaacgaatacctccctagtcaccaa
ttttcagtctctgagcgaacggctgccaagattttgaaagaaaacaaggcagactggata
aagcacaatttcaaacatatctcaagggtttatccacggggtaccagacttgggtcgaca
aattataatcctgtcgatgcttggtccgccggctgtcagattgtggccttaaactggcaa
accctggatgaatcaatattgctgaatcacgccatgtttcacggcagtaacgggtacatc
ctcaaaccacttgctctacgtgaaaaggtcgttgaaaagcctgaaagataccttctcacg
gtgcgaatcatctctgggcaacgcacaccactttttgccgatctttacgtcgaggcaact
cttaacggaaaaatctccaaacgcactcgcacactcagtcaagttactctcaatccacta
tgggatgaaatcttgacatttgaaatcaccaccacaccgagttcattgatgctcaacttt
ctacatttagaagtcagaaataaaactttgcaagcccaatggatgaggccagtcggtctc
gcaccccaagggtaccatcacttgccattatatgatagtcttttgtcacgattcgtcttc
gcgaccttgtttgtggagataacgataaagaaactgtag

DBGET integrated database retrieval system