KEGG   Cryptococcus gattii: CGB_C7130WHelp
Entry
CGB_C7130W        CDS       T02232                                 

Definition
phosphoinositide phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cgi  Cryptococcus gattii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cgi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cgi04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:join(1411734..1411946,1412014..1412410,1412460..1412746,1412807..1413688)
Genome map
AA seq 592 aa AA seqDB search
MIALTDEIYFLWIKTLKQLVSITLDRQVTDITPSDPDMLWIRQLWPLGTKAINREKAEAL
CAQIGLQIKADGMLDIKAFHELIKASQTRPDINLVYRDLTMSGPLDEGRVIAFLTHVQHI
SPSSAEELFNKYKSEDLWTIDSLTSFFSSSDNTPNQTQDMTHPLQHYFISSSHNTYLVGE
QWKGESTVEGYIRVLLAGCRCVEMDVQSGDVEPVVYHRKTLTSSVPVRDICRAIKQYGFV
TSPYPIIISTEIHCVPEQQNRLAAILKEVFGDMLVSTPLVEEFSDLPSPEDLKGKILFKA
KPPKPEPNSPKLESNFVYQESPSSTDSDTSFVRLARRLSIQSKAERPDIFSPRLSELLVY
THGVKYRGFSKLNEYLPSHQFSVSERTAAKILKENKADWIKHNFKHISRVYPRGTRLGST
NYNPVDAWSAGCQIVALNWQTLDESILLNHAMFHGSNGYILKPLALREKVVEKPERYLLT
VRIISGQRTPLFADLYVEATLNGKISKRTRTLSQVTLNPLWDEILTFEITTTPSSLMLNF
LHLEVRNKTLQAQWMRPVGLAPQGYHHLPLYDSLLSRFVFATLFVEITIKKL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttaccgatgagatatatttcctttggatcaagacgttgaagcagctggtc
tctatcactctggatcgccaggttaccgacatcacgccatctgacccagatatgctctgg
attagacagttatggcctctaggcaccaaagccattaatcgtgagaaggccgaagcgtta
tgcgcgcagatcggattgcaaatcaaagccgatggtatgctagacatcaaagccttccat
gaacttattaaggctagccagactcgacctgacattaatctggtttaccgcgacctcacc
atgagtggtcctctagatgagggacgcgttatcgcttttcttacacatgtacaacatatt
tcaccttcttctgccgaggaactgttcaacaagtataagtctgaagatttgtggaccata
gactctctgacctccttcttctcctcgtccgacaatactcctaatcaaacccaggatatg
actcatcctcttcaacactatttcatctcgagttcgcacaatacatatcttgtgggagag
caatggaaaggtgagagtacagtggagggttatattcgtgtgttgttggcaggttgtcga
tgtgtagagatggatgtgcaatctggtgatgttgaacctgtcgtgtaccatcgtaaaact
ttgacatcgagtgtgccagtccgagacatctgccgtgccattaagcagtatggttttgtg
acatcgccctatcctataattatctccactgagattcactgcgtcccagagcagcaaaac
cgattagcagccatattaaaggaagtttttggtgatatgctggtttccacgcctctggtt
gaagaattttcggacctgcctagtcctgaagatttgaagggcaaaattctcttcaaggcc
aaacctcccaaacccgaaccaaattcaccaaaactcgaaagcaacttcgtctatcaagag
tcaccttcatccactgattccgatactagtttcgttcgtcttgctcgccgtctttcaata
caatccaaggccgaacgcccggacatcttttccccccggctttcagaacttctcgtctat
actcatggtgtaaagtatcgaggcttttccaaactcaacgaatacctccctagtcaccaa
ttttcagtctctgagcgaacggctgccaagattttgaaagaaaacaaggcagactggata
aagcacaatttcaaacatatctcaagggtttatccacggggtaccagacttgggtcgaca
aattataatcctgtcgatgcttggtccgccggctgtcagattgtggccttaaactggcaa
accctggatgaatcaatattgctgaatcacgccatgtttcacggcagtaacgggtacatc
ctcaaaccacttgctctacgtgaaaaggtcgttgaaaagcctgaaagataccttctcacg
gtgcgaatcatctctgggcaacgcacaccactttttgccgatctttacgtcgaggcaact
cttaacggaaaaatctccaaacgcactcgcacactcagtcaagttactctcaatccacta
tgggatgaaatcttgacatttgaaatcaccaccacaccgagttcattgatgctcaacttt
ctacatttagaagtcagaaataaaactttgcaagcccaatggatgaggccagtcggtctc
gcaccccaagggtaccatcacttgccattatatgatagtcttttgtcacgattcgtcttc
gcgaccttgtttgtggagataacgataaagaaactgtag

DBGET integrated database retrieval system