KEGG   Cryptococcus gattii: CGB_C7680CHelp
Entry
CGB_C7680C        CDS       T02232                                 

Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cgi  Cryptococcus gattii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CGB_C7680C
Enzymes [BR:cgi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CGB_C7680C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(1550990..1551447,1551495..1551642,1551687..1551779,1551831..1552163,1552210..1552344))
Genome map
AA seq 388 aa AA seqDB search
MKLTWSAIITAALLPLSAYAGMYGQPVLHLNSKTFKSVMANEHAAMVAFVAPWCGHCKNL
GPEYTAAAQSLSPLIPFYAVDCDDASNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGER
KRGALVEYAKGLVPERVKKLRVQGDIQSDVQSFLEEKSELPHVLLVHPSSPSIPFLWKVL
AHRFSNKLHFGYIRDTTSHNVLSLLGIYDPADTTRDSTRVVAWSPGPQSGELVEYDGILK
FNALLEWLQTTFPSAAPSNTKQQPVKAPQSTVKSNDKKQEQISTQSQNDAAARRAKLEEI
ERRDRVRREKAAEAASAQAMVTVPEPEIEKEATPVEDAADAAPAQVVEDTSLPAEEVEPK
PMPEEAPEDEAAAGDVEVEKTEVVHEEL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcacctggtccgcaataataacagcagcgctgttacctctttccgcctatgca
ggcatgtatggccagcctgttcttcatctcaactccaaaacattcaagtccgtcatggcc
aatgaacatgcggcgatggtcgcctttgtggcaccatggtgtgggcactgtaaaaatctc
ggacccgaatataccgctgctgcccaatctctttcgcctctgatcccgttctatgctgtt
gactgtgacgacgcgtccaaccgtgggctttgtgccgaatatggcgttcaaggatatcca
actattaaaggcttccccaaggctgggaaaggagctgctaaggaatacaatggtgaaagg
aagaggggtgcattagtggaatacgcgaaggggttggttcccgagagagtcaagaagttg
agagttcagggagacattcagtctgatgtgcaaagttttttagaggagaaatctgagctc
ccgcatgtccttcttgttcacccctcgtcgccttctatcccttttctatggaaggttctc
gctcaccgtttttccaacaagctccatttcggatacataagagatactacgtcacataat
gttctttcattgctcggcatctacgacccggcagacactactcgtgacagtacacgagtc
gtggcttggtctcctggtcctcaaagcggggaacttgtagaatatgatggcattcttaaa
ttcaacgccctcctcgagtggctccaaaccacctttccatccgccgctccttctaacact
aagcaacaacctgtcaaagctcctcagtcaaccgtcaaatcgaacgataagaagcaggag
caaatttctacacaatctcaaaatgatgccgctgccaggagggccaagttggaagagata
gaaaggagggacagggtcagaagggagaaggcggctgaagctgcaagtgctcaagcgatg
gtcactgtgccggaacccgagatagaaaaggaggctactcctgtggaggacgcggcggac
gctgcccctgcgcaagtggtagaagacacctctttgccagctgaagaagtggaaccaaaa
cctatgcctgaggaagcgcccgaggatgaagcggcagcgggcgatgtggaggttgagaaa
actgaagtggttcatgaggaattataa

DBGET integrated database retrieval system