KEGG   Cryptococcus gattii: CGB_D3470WHelp
Entry
CGB_D3470W        CDS       T02232                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cgi  Cryptococcus gattii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cgi00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(815882..815965,816033..816341,816402..816806,816864..817047,817104..818006,818071..818398,818465..818555)
Genome map
AA seq 767 aa AA seqDB search
MSLAPRKRRTDRNESPSLPVRSYSDDDKQRTPKPPLSAPSLRNEYIISWSTATALTIAAC
VVRFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAKMLNGLAAWVVGFDGNFRF
DQIGDSYTDAGVPYVGMRNFCAILGSLTIPVVYAIMRESGYPVGIAAFSAALIVFDNGHI
TQTRLILLDAALVLFMALSLFCYIKFHQYRYQEFSRAWWGWLLATGFWLACTLGCKMVGL
FTFVTVGAAVLWDLWEILDIKKGHSMSYWTKHFVYRAIGLIIVPFFIYLSFFWVHFKILK
FSGPGDTFMSPAFQETLQGNELLMNAQEIRYYDTITVRHKDTKQYLHSHDERYPLRYDDG
RISSQGQQVTCYPHNDTNNHWQVIPTKEIPESGRGRIVRHNDVIQLKHINTQTLLLTHDV
ASPLMPTNQEFTTVSPDNEERRNDTLFKMVLNDAHDGEAWKTLSGHFRLIHVPTKVALWT
HPKALPEWAFGQQEVNGNKNSAERSTLWFVNDIVEDGQGFDFKNRTVQVEPKAVKKRAFI
KKWFELQVLMLQHNAGLTSTHPYQSTPIEWPFCLSGISFWTRNEGQQQIYMVGNLLGWWI
CAVTVSVYVGVVAADMLARRRGIHPIEDGVRNRLYRNTGFFLGAWAFHYFPFYLMSRQRF
LHHYLPAHLASVLVAGSVMNFILIEAVNYPISIAGPTTRLRPAVRAKLNKPAKMVIAGLL
IIVIGVYLFLSPLTYGQSMTGEEVNRRKLLSTWSLHFEAKKTHSLDE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagcccctcgcaagaggcgcacggacaggaatgagtccccatctctccccgtg
aggtcttacagtgatgacgacaagcaacgcactcccaaaccacctctttcagcaccttct
ctgcgcaatgagtacatcatatcgtggtcaacagcaacggccttgaccatcgcagcctgc
gtcgtccgattttggcgcatcgcccacccggaccaagtcgtctttgatgaagtccatttt
ggatcctttgcagctcaatacatcaagagggagtactactttgatgttcacccaccgctg
gcaaagatgttgaatggtctggcggcttgggttgtaggatttgatggaaactttcggttt
gatcaaattggtgacagctatacagatgctggtgtcccctacgttgggatgagaaacttc
tgcgcgatcctcggatccctcacgatccccgttgtctacgccatcatgcgagaatctggc
tatcctgtcggcattgctgccttttctgcggctctgattgtatttgacaacggtcacatc
acccagacccgacttattctccttgacgctgctctcgttcttttcatggccctttccctg
ttctgttacatcaagttccaccaatacagataccaagaattttcccgggcttggtgggga
tggttgcttgccactggattctggctggcttgtaccttgggatgcaagatggtgggcttg
ttcacctttgtgaccgttggcgccgctgttctttgggacttgtgggaaattttggacatc
aaaaagggacattctatgtcttactggaccaagcatttcgtttaccgtgccataggactg
ataatcgtaccattcttcatttacttgtctttcttctgggtgcacttcaagatcctcaag
ttttccggtcccggtgacactttcatgagccctgctttccaggaaaccctgcaagggaat
gagctgctcatgaacgctcaagaaatccgatactacgatactatcaccgtacgtcacaag
gatacgaagcaatacctccactcgcacgatgaacgatatcccttgagatatgatgatggc
cgtatcagttctcaaggccagcaagtcacctgctatccccacaacgacacaaacaaccac
tggcaagtcatccctaccaaggaaatccccgaatctggtcgtggcaggatcgtgcgacac
aacgacgtcattcaactgaagcacatcaacacccaaactcttttgcttacgcacgatgtg
gcttcaccacttatgccgaccaaccaagagttcacgactgtttctcccgacaacgaagag
agaagaaatgataccttgttcaagatggtactcaacgacgctcatgatggcgaagcgtgg
aagactctgtctgggcattttaggcttatccacgtacctaccaaggtcgctctttggaca
caccctaaagcgcttcctgaatgggcattcggacagcaggaggtgaacggaaacaagaat
tcggctgaacgctcgactctttggttcgtcaatgatatcgtggaagatgggcagggtttc
gacttcaagaaccgcacggtccaggtcgagcccaaagctgtcaagaagcgtgcattcatc
aagaagtggtttgagctccaagttcttatgctccagcataatgcgggccttacttccact
catccttatcaatctacacccatcgaatggccgttttgcttgagtggtatcagtttctgg
acacgtaatgagggtcaacaacagatttatatggttggaaaccttttaggttggtggatc
tgtgctgtgacggtgtccgtctacgtcggtgttgtcgccgcggatatgcttgcgaggagg
cgaggcatacatcctatcgaagatggtgtacgaaaccgtttgtaccgcaacactggattc
ttcctcggggcctgggcgttccattactttccattctatctcatgagtcgacaacgtttc
ttgcaccactaccttcctgctcatcttgcttccgtcctcgttgccggatcggtgatgaac
tttatcctcattgaggctgtcaactaccccatcagtattgccggtccgaccacaagattg
cggcctgcagtgcgtgccaaactgaacaagccagctaaaatggtgattgctggtttgttg
atcattgtaattggagtgtatctcttcctgagtccattgacatatgggcagtcgatgacg
ggagaagaggtgaatcgaagaaaattgttaagcacttggtcattacactttgaggccaag
aagacgcattcgctggatgagtga

DBGET integrated database retrieval system