KEGG   Cryptococcus gattii: CGB_D3470WHelp
Entry
CGB_D3470W        CDS       T02232                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cgi  Cryptococcus gattii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CGB_D3470W
Enzymes [BR:cgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CGB_D3470W
Glycosyltransferases [BR:cgi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CGB_D3470W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(815882..815965,816033..816341,816402..816806,816864..817047,817104..818006,818071..818398,818465..818555)
Genome map
AA seq 767 aa AA seqDB search
MSLAPRKRRTDRNESPSLPVRSYSDDDKQRTPKPPLSAPSLRNEYIISWSTATALTIAAC
VVRFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAKMLNGLAAWVVGFDGNFRF
DQIGDSYTDAGVPYVGMRNFCAILGSLTIPVVYAIMRESGYPVGIAAFSAALIVFDNGHI
TQTRLILLDAALVLFMALSLFCYIKFHQYRYQEFSRAWWGWLLATGFWLACTLGCKMVGL
FTFVTVGAAVLWDLWEILDIKKGHSMSYWTKHFVYRAIGLIIVPFFIYLSFFWVHFKILK
FSGPGDTFMSPAFQETLQGNELLMNAQEIRYYDTITVRHKDTKQYLHSHDERYPLRYDDG
RISSQGQQVTCYPHNDTNNHWQVIPTKEIPESGRGRIVRHNDVIQLKHINTQTLLLTHDV
ASPLMPTNQEFTTVSPDNEERRNDTLFKMVLNDAHDGEAWKTLSGHFRLIHVPTKVALWT
HPKALPEWAFGQQEVNGNKNSAERSTLWFVNDIVEDGQGFDFKNRTVQVEPKAVKKRAFI
KKWFELQVLMLQHNAGLTSTHPYQSTPIEWPFCLSGISFWTRNEGQQQIYMVGNLLGWWI
CAVTVSVYVGVVAADMLARRRGIHPIEDGVRNRLYRNTGFFLGAWAFHYFPFYLMSRQRF
LHHYLPAHLASVLVAGSVMNFILIEAVNYPISIAGPTTRLRPAVRAKLNKPAKMVIAGLL
IIVIGVYLFLSPLTYGQSMTGEEVNRRKLLSTWSLHFEAKKTHSLDE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagcccctcgcaagaggcgcacggacaggaatgagtccccatctctccccgtg
aggtcttacagtgatgacgacaagcaacgcactcccaaaccacctctttcagcaccttct
ctgcgcaatgagtacatcatatcgtggtcaacagcaacggccttgaccatcgcagcctgc
gtcgtccgattttggcgcatcgcccacccggaccaagtcgtctttgatgaagtccatttt
ggatcctttgcagctcaatacatcaagagggagtactactttgatgttcacccaccgctg
gcaaagatgttgaatggtctggcggcttgggttgtaggatttgatggaaactttcggttt
gatcaaattggtgacagctatacagatgctggtgtcccctacgttgggatgagaaacttc
tgcgcgatcctcggatccctcacgatccccgttgtctacgccatcatgcgagaatctggc
tatcctgtcggcattgctgccttttctgcggctctgattgtatttgacaacggtcacatc
acccagacccgacttattctccttgacgctgctctcgttcttttcatggccctttccctg
ttctgttacatcaagttccaccaatacagataccaagaattttcccgggcttggtgggga
tggttgcttgccactggattctggctggcttgtaccttgggatgcaagatggtgggcttg
ttcacctttgtgaccgttggcgccgctgttctttgggacttgtgggaaattttggacatc
aaaaagggacattctatgtcttactggaccaagcatttcgtttaccgtgccataggactg
ataatcgtaccattcttcatttacttgtctttcttctgggtgcacttcaagatcctcaag
ttttccggtcccggtgacactttcatgagccctgctttccaggaaaccctgcaagggaat
gagctgctcatgaacgctcaagaaatccgatactacgatactatcaccgtacgtcacaag
gatacgaagcaatacctccactcgcacgatgaacgatatcccttgagatatgatgatggc
cgtatcagttctcaaggccagcaagtcacctgctatccccacaacgacacaaacaaccac
tggcaagtcatccctaccaaggaaatccccgaatctggtcgtggcaggatcgtgcgacac
aacgacgtcattcaactgaagcacatcaacacccaaactcttttgcttacgcacgatgtg
gcttcaccacttatgccgaccaaccaagagttcacgactgtttctcccgacaacgaagag
agaagaaatgataccttgttcaagatggtactcaacgacgctcatgatggcgaagcgtgg
aagactctgtctgggcattttaggcttatccacgtacctaccaaggtcgctctttggaca
caccctaaagcgcttcctgaatgggcattcggacagcaggaggtgaacggaaacaagaat
tcggctgaacgctcgactctttggttcgtcaatgatatcgtggaagatgggcagggtttc
gacttcaagaaccgcacggtccaggtcgagcccaaagctgtcaagaagcgtgcattcatc
aagaagtggtttgagctccaagttcttatgctccagcataatgcgggccttacttccact
catccttatcaatctacacccatcgaatggccgttttgcttgagtggtatcagtttctgg
acacgtaatgagggtcaacaacagatttatatggttggaaaccttttaggttggtggatc
tgtgctgtgacggtgtccgtctacgtcggtgttgtcgccgcggatatgcttgcgaggagg
cgaggcatacatcctatcgaagatggtgtacgaaaccgtttgtaccgcaacactggattc
ttcctcggggcctgggcgttccattactttccattctatctcatgagtcgacaacgtttc
ttgcaccactaccttcctgctcatcttgcttccgtcctcgttgccggatcggtgatgaac
tttatcctcattgaggctgtcaactaccccatcagtattgccggtccgaccacaagattg
cggcctgcagtgcgtgccaaactgaacaagccagctaaaatggtgattgctggtttgttg
atcattgtaattggagtgtatctcttcctgagtccattgacatatgggcagtcgatgacg
ggagaagaggtgaatcgaagaaaattgttaagcacttggtcattacactttgaggccaag
aagacgcattcgctggatgagtga

DBGET integrated database retrieval system