KEGG   Cryptococcus gattii: CGB_D3540CHelp
Entry
CGB_D3540C        CDS       T02232                                 

Definition
NADPH--cytochrome P450 reductase (CPR) (P450R)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cgi  Cryptococcus gattii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(837944..837970,838032..838243,838300..838537,838589..840148,840207..840395))
Genome map
AA seq 741 aa AA seqDB search
MPSAIDIVIIVLTVALPVLYFFRESLPFIGGRTRAAAPHAPVANKTSVEEGDPSDFVGKM
RRANKRCVIFYGSQTGTAEEYAIRLAKEAKSRYGISSLVCDPEEYDMNLLDQVPEDACVI
FVMATYGEGEPTDNASAMMELLQESEPEFSQGGSTLENLNYVIFGLGNRTYEFYNEVAKK
LDKRLTELGAKRIGERGEGDDDKSMEEDYLAWKDPMWTAFAERMGVEEGGAGDVADFVVR
ELHNHNPEKVYHGELSSRALLASASGTNTPVGAYGVKNPYPAPVLASKELFAVGGDRNCI
HIEFDITGSGMTYQHGDHVGIWPTNSDVEVDRMLAVLGLAGPGRRQAIVDIESLDPALAK
VPFPTPATYEAIFRNYLDISAVASRQTIAFLARYAPSEAAHEKLTRWGTDKEAYANEIDG
PALKLAEVLQAASNDSVEPPFASQTVWPIPFDRIVSSVPRLQPRYYSISSSSKLHPSAIH
VTAVVLKYQPTVSPTHHHEPRWVFGLSTNFILNVKMAHSGENTPVEGDASQVSMKKIPTY
KLAGPRGHYVKENIYKVPIHVRRSTFRLPTSPKVPIIMIGPGTGVAPFRGFVQERIALAR
KAIDKNGPDALKDWAPMYLFYGCRRADEDFLYREEWPTYEQELKGVFRMKVAFSREMKKP
DGGKVYVQDLIHDLASELAPLILEKRAYIYICGDAKNMSKAVEERLMEMLGAAKGGSAAV
EGAKELKLLKERNRLMSDVWS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgcaatagacatcgtgatcattgtgctcacagtcgcgctcccggttctctac
tttttccgcgagtcgctccctttcatcgggggaagaactcgagctgccgctcctcatgct
cctgtagccaacaagactagtgttgaagagggtgaccctagtgactttgttgggaaaatg
agaagagctaacaagcgctgtgtcatcttctatggttctcaaactggtactgccgaagaa
tacgctatccgtcttgccaaggaagccaaatctcgctacggtatctcgtcccttgtctgc
gatcctgaagaatacgacatgaacttgcttgaccaggttcctgaggacgcctgtgtcatt
tttgttatggcgacatacggcgagggtgaaccgacagataatgccagtgccatgatggaa
cttcttcaagaatcggaacccgaattttcccagggcggcagcacccttgagaacctcaac
tatgtcatctttggtctcgggaacaggacgtacgagttttacaacgaagttgccaagaag
ctggacaaaaggttgactgagctcggcgcgaagagaattggagagcgcggtgaaggtgac
gatgacaagagcatggaggaggactatctggcttggaaagaccccatgtggacagcattt
gctgagagaatgggtgtggaggaaggcggcgctggtgatgttgccgacttcgtagtcagg
gaattgcataatcacaacccggaaaaggtttaccacggcgaactgtcttctcgagcactc
cttgcctcggctagcggtaccaacacaccagttggagcgtatggcgtaaaaaatccttac
cctgcccctgttctcgcctccaaagagcttttcgctgtaggcggcgacaggaattgcatt
cacatcgaatttgatattactggctctggtatgacctatcaacatggtgaccatgtcggt
atctggcctaccaactcagacgttgaggtcgaccgtatgttggctgtccttggtctggcc
ggccctggccgtcgtcaggccattgtcgatatcgagtccctcgatcccgctcttgccaag
gtgcctttccctactcctgctacctatgaagctattttccgtaactacctcgacatttcc
gcagttgcttctcgtcaaacaatcgcttttctcgctcgctatgctccttccgaggcagct
catgagaagctcactaggtggggtactgacaaggaggcatacgccaacgagatagacggt
ccagctctcaaacttgctgaggttctccaagctgcctccaacgactctgttgagccccct
ttcgcgtcccaaacagtttggccgatcccctttgaccgcattgtgtcttcggtccctcgt
cttcagcctcgctactactcgatctcgtcctcttcaaaacttcaccctagtgctatccac
gttactgcggttgtactcaagtaccagcctacggttagtccaactcaccaccacgagcct
cgatgggtcttcggcttgtctaccaacttcattctcaacgtcaagatggcccactctggc
gagaacaccccagttgagggcgatgcttctcaggtctccatgaagaagatcccaacgtac
aagctcgctggtccccgaggtcattatgtgaaggaaaatatctacaaagtgcccatccac
gtgaggcgaagcacctttaggctccctacttctcccaaggtcccaatcattatgatcggt
cccggtactggtgttgctcccttccgcgggtttgtacaagaacgcattgctctcgctcga
aaggctatcgacaaaaacggtcccgatgctctcaaggactgggccccaatgtaccttttc
tacgggtgccgccgagccgacgaggatttcctgtaccgcgaagagtggcctacctatgag
caagagctcaagggcgttttcagaatgaaagtggccttctcaagggagatgaagaagcct
gatgggggcaaggtatacgtacaagatcttatccacgacctcgcttccgagctcgctccg
cttattttggagaagcgtgcttacatttacatctgcggtgacgccaagaacatgtccaag
gctgtggaagagagactaatggagatgttgggcgcggcgaagggtggcagtgcggctgtg
gagggtgccaaagagttgaagttattgaaggagaggaacaggttgatgagcgatgtctgg
agttag

DBGET integrated database retrieval system